Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 4 1
Sequence
Reactive Loop      Linker
KVCPRNCDPKIRYGRCPKSGNKKFNVGCTNCCAAKKGCNYFSANGTFVCKG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
L-65 GNKKF 20 - 24 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 31
Bond 2 7 - 32
Bond 3 16 - 28
Bond 4 38 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K V C P R N C D P K I R Y G R C P K S G N K K F N V G C T N C C A A K K G C N Y F S A N G T F V C K G


Amino Acid Count Percentage
Alanine 3 5.882352941
Cysteine 8 15.68627451
Aspartic acid 1 1.960784314
Glutamic acid 0 0
Phenylalanine 3 5.882352941
Glycine 6 11.76470588
Histidine 0 0
Isoleucine 1 1.960784314
Lysine 8 15.68627451
Leucine 0 0
Methionine 0 0
Asparagine 6 11.76470588
Proline 3 5.882352941
Glutamine 0 0
Arginine 3 5.882352941
Serine 2 3.921568627
Threonine 2 3.921568627
Valine 3 5.882352941
Tryptophan 0 0
Tyrosine 2 3.921568627