Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 4 1
Sequence
Reactive Loop      Linker
NACPRNCNPSIQYGRCPKSGNKKFKVGCTNCCSGTEGCNYYSANGTFICEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
L-65 GNKKF 20 - 24 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 32
Bond 3 16 - 38
Bond 4 31 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
N A C P R N C N P S I Q Y G R C P K S G N K K F K V G C T N C C S G T E G C N Y Y S A N G T F I C E G


Amino Acid Count Percentage
Alanine 2 3.921568627
Cysteine 8 15.68627451
Aspartic acid 0 0
Glutamic acid 2 3.921568627
Phenylalanine 2 3.921568627
Glycine 7 13.7254902
Histidine 0 0
Isoleucine 2 3.921568627
Lysine 4 7.843137255
Leucine 0 0
Methionine 0 0
Asparagine 7 13.7254902
Proline 3 5.882352941
Glutamine 1 1.960784314
Arginine 2 3.921568627
Serine 4 7.843137255
Threonine 3 5.882352941
Valine 1 1.960784314
Tryptophan 0 0
Tyrosine 3 5.882352941