Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 4 1
Sequence
Reactive Loop      Linker
KACPRNCDPRIAYGLCPLSKEKDNRICINCCAGTKGCNYFSADGTFVCKG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
L-31 KEKDN 20 - 24 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 27
Bond 2 7 - 31
Bond 3 16 - 37
Bond 4 30 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K A C P R N C D P R I A Y G L C P L S K E K D N R I C I N C C A G T K G C N Y F S A D G T F V C K G


Amino Acid Count Percentage
Alanine 4 8
Cysteine 8 16
Aspartic acid 3 6
Glutamic acid 1 2
Phenylalanine 2 4
Glycine 5 10
Histidine 0 0
Isoleucine 3 6
Lysine 5 10
Leucine 2 4
Methionine 0 0
Asparagine 4 8
Proline 3 6
Glutamine 0 0
Arginine 3 6
Serine 2 4
Threonine 2 4
Valine 1 2
Tryptophan 0 0
Tyrosine 2 4