Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 3 1
Sequence
Reactive Loop      Linker
KDCPRNCDPRIDYRVCRRSEEKNNQICTNCCAGTKGYNYFSADGTFVCKG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
L-27 EEKNN 20 - 24 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 31
Bond 2 7 - 30
Bond 3 16 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K D C P R N C D P R I D Y R V C R R S E E K N N Q I C T N C C A G T K G Y N Y F S A D G T F V C K G


Amino Acid Count Percentage
Alanine 2 4
Cysteine 7 14
Aspartic acid 4 8
Glutamic acid 2 4
Phenylalanine 2 4
Glycine 4 8
Histidine 0 0
Isoleucine 2 4
Lysine 4 8
Leucine 0 0
Methionine 0 0
Asparagine 5 10
Proline 2 4
Glutamine 1 2
Arginine 5 10
Serine 2 4
Threonine 3 6
Valine 2 4
Tryptophan 0 0
Tyrosine 3 6