Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 4 1
Sequence
Reactive Loop      Linker
KACPRNCDGRIAYGICPRTEEKNNQICTNCCAGTKGCNYFSANGTFICEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
L-27 EEKNN 20 - 24 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 27
Bond 2 7 - 31
Bond 3 16 - 37
Bond 4 30 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K A C P R N C D G R I A Y G I C P R T E E K N N Q I C T N C C A G T K G C N Y F S A N G T F I C E G


Amino Acid Count Percentage
Alanine 4 8
Cysteine 8 16
Aspartic acid 1 2
Glutamic acid 3 6
Phenylalanine 2 4
Glycine 6 12
Histidine 0 0
Isoleucine 4 8
Lysine 3 6
Leucine 0 0
Methionine 0 0
Asparagine 6 12
Proline 2 4
Glutamine 1 2
Arginine 3 6
Serine 1 2
Threonine 4 8
Valine 0 0
Tryptophan 0 0
Tyrosine 2 4