Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
MACPLYCLDVEYMTCNGTKVTPGRCNCCLAPKGCILHLSDGTSVNCG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-27 CPLYC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 25
Bond 2 7 - 15
Bond 3 27 - 46
Bond 4 28 - 34
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47
M A C P L Y C L D V E Y M T C N G T K V T P G R C N C C L A P K G C I L H L S D G T S V N C G


Amino Acid Count Percentage
Alanine 2 4.255319149
Cysteine 8 17.0212766
Aspartic acid 2 4.255319149
Glutamic acid 1 2.127659574
Phenylalanine 0 0
Glycine 5 10.63829787
Histidine 1 2.127659574
Isoleucine 1 2.127659574
Lysine 2 4.255319149
Leucine 5 10.63829787
Methionine 2 4.255319149
Asparagine 3 6.382978723
Proline 3 6.382978723
Glutamine 0 0
Arginine 1 2.127659574
Serine 2 4.255319149
Threonine 4 8.510638298
Valine 3 6.382978723
Tryptophan 0 0
Tyrosine 2 4.255319149