Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KACPLYCLDVVSMTCNGTEVNFTSCNCCLAPKGCTLHLADGGSVYCG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-27 CPLYC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 27
Bond 2 7 - 28
Bond 3 15 - 34
Bond 4 25 - 46
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47
K A C P L Y C L D V V S M T C N G T E V N F T S C N C C L A P K G C T L H L A D G G S V Y C G


Amino Acid Count Percentage
Alanine 3 6.382978723
Cysteine 8 17.0212766
Aspartic acid 2 4.255319149
Glutamic acid 1 2.127659574
Phenylalanine 1 2.127659574
Glycine 5 10.63829787
Histidine 1 2.127659574
Isoleucine 0 0
Lysine 2 4.255319149
Leucine 5 10.63829787
Methionine 1 2.127659574
Asparagine 3 6.382978723
Proline 2 4.255319149
Glutamine 0 0
Arginine 0 0
Serine 3 6.382978723
Threonine 4 8.510638298
Valine 4 8.510638298
Tryptophan 0 0
Tyrosine 2 4.255319149