Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 0 1
Sequence
Reactive Loop      Linker
KICPQYCLDVEYMTCGSSCERLEPKCNCCLAPEGCTLHLADGTSEYCG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-33 CPQYC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48
K I C P Q Y C L D V E Y M T C G S S C E R L E P K C N C C L A P E G C T L H L A D G T S E Y C G


Amino Acid Count Percentage
Alanine 2 4.166666667
Cysteine 9 18.75
Aspartic acid 2 4.166666667
Glutamic acid 5 10.41666667
Phenylalanine 0 0
Glycine 4 8.333333333
Histidine 1 2.083333333
Isoleucine 1 2.083333333
Lysine 2 4.166666667
Leucine 5 10.41666667
Methionine 1 2.083333333
Asparagine 1 2.083333333
Proline 3 6.25
Glutamine 1 2.083333333
Arginine 1 2.083333333
Serine 3 6.25
Threonine 3 6.25
Valine 1 2.083333333
Tryptophan 0 0
Tyrosine 3 6.25