Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
PACPQYCLSDADYVICNSPVPAKYPVSCGNCCFARSAVGSSKDCSIHFTDGRLQACG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-33 CPQYC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 31
Bond 2 7 - 32
Bond 3 16 - 44
Bond 4 28 - 56
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57
P A C P Q Y C L S D A D Y V I C N S P V P A K Y P V S C G N C C F A R S A V G S S K D C S I H F T D G R L Q A C G


Amino Acid Count Percentage
Alanine 6 10.52631579
Cysteine 8 14.03508772
Aspartic acid 4 7.01754386
Glutamic acid 0 0
Phenylalanine 2 3.50877193
Glycine 4 7.01754386
Histidine 1 1.754385965
Isoleucine 2 3.50877193
Lysine 2 3.50877193
Leucine 2 3.50877193
Methionine 0 0
Asparagine 2 3.50877193
Proline 5 8.771929825
Glutamine 2 3.50877193
Arginine 2 3.50877193
Serine 7 12.28070175
Threonine 1 1.754385965
Valine 4 7.01754386
Tryptophan 0 0
Tyrosine 3 5.263157895