Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 3 1
Sequence
Reactive Loop      Linker
KTCTFKCGSASYVCPGPKSVALDFNSCHTCRKPLKEGCKLYNRQGHQLCV
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-60 CTFKC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 30
Bond 2 7 - 38
Bond 3 14 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K T C T F K C G S A S Y V C P G P K S V A L D F N S C H T C R K P L K E G C K L Y N R Q G H Q L C V


Amino Acid Count Percentage
Alanine 2 4
Cysteine 7 14
Aspartic acid 1 2
Glutamic acid 1 2
Phenylalanine 2 4
Glycine 4 8
Histidine 2 4
Isoleucine 0 0
Lysine 6 12
Leucine 4 8
Methionine 0 0
Asparagine 2 4
Proline 3 6
Glutamine 2 4
Arginine 2 4
Serine 4 8
Threonine 3 6
Valine 3 6
Tryptophan 0 0
Tyrosine 2 4