Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 2 1
Sequence
Reactive Loop      Linker
KVCIEICLEANYMTCPSTGNAELNPACNCYLANEDGCTIYLKDGTVEKCPR
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-61 CIEIC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 7 - 37
Bond 2 29 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K V C I E I C L E A N Y M T C P S T G N A E L N P A C N C Y L A N E D G C T I Y L K D G T V E K C P R


Amino Acid Count Percentage
Alanine 4 7.843137255
Cysteine 7 13.7254902
Aspartic acid 2 3.921568627
Glutamic acid 5 9.803921569
Phenylalanine 0 0
Glycine 3 5.882352941
Histidine 0 0
Isoleucine 3 5.882352941
Lysine 3 5.882352941
Leucine 4 7.843137255
Methionine 1 1.960784314
Asparagine 5 9.803921569
Proline 3 5.882352941
Glutamine 0 0
Arginine 1 1.960784314
Serine 1 1.960784314
Threonine 4 7.843137255
Valine 2 3.921568627
Tryptophan 0 0
Tyrosine 3 5.882352941