Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 2 1
Sequence
Reactive Loop      Linker
KACSKECDPRIDIGFCAYVQTKIVNGLSTNCSAGKKGCKYFSNDGT
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-13 CSKEC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 31
Bond 2 16 - 38
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46
K A C S K E C D P R I D I G F C A Y V Q T K I V N G L S T N C S A G K K G C K Y F S N D G T


Amino Acid Count Percentage
Alanine 3 6.52173913
Cysteine 5 10.86956522
Aspartic acid 3 6.52173913
Glutamic acid 1 2.173913043
Phenylalanine 2 4.347826087
Glycine 5 10.86956522
Histidine 0 0
Isoleucine 3 6.52173913
Lysine 6 13.04347826
Leucine 1 2.173913043
Methionine 0 0
Asparagine 3 6.52173913
Proline 1 2.173913043
Glutamine 1 2.173913043
Arginine 1 2.173913043
Serine 4 8.695652174
Threonine 3 6.52173913
Valine 2 4.347826087
Tryptophan 0 0
Tyrosine 2 4.347826087