Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 3 4 2
Sequence
Reactive Loop      Linker
KVCTMECGNFAYGICPRSEGSPICTNCCSGYKGCNYYSANGTFICEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-19 CTMEC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 34
Bond 3 15 - 24
Bond 4 27 - 45
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47
K V C T M E C G N F A Y G I C P R S E G S P I C T N C C S G Y K G C N Y Y S A N G T F I C E G


Amino Acid Count Percentage
Alanine 2 4.255319149
Cysteine 8 17.0212766
Aspartic acid 0 0
Glutamic acid 3 6.382978723
Phenylalanine 2 4.255319149
Glycine 7 14.89361702
Histidine 0 0
Isoleucine 3 6.382978723
Lysine 2 4.255319149
Leucine 0 0
Methionine 1 2.127659574
Asparagine 4 8.510638298
Proline 2 4.255319149
Glutamine 0 0
Arginine 1 2.127659574
Serine 4 8.510638298
Threonine 3 6.382978723
Valine 1 2.127659574
Tryptophan 0 0
Tyrosine 4 8.510638298