Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 0 1
Sequence
Reactive Loop      Linker
KACPRNCDTRIAYSKMSTFRRKTQKIAYAPIAVQAVRVATNYSADGTFICEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
K A C P R N C D T R I A Y S K M S T F R R K T Q K I A Y A P I A V Q A V R V A T N Y S A D G T F I C E G


Amino Acid Count Percentage
Alanine 8 15.38461538
Cysteine 3 5.769230769
Aspartic acid 2 3.846153846
Glutamic acid 1 1.923076923
Phenylalanine 2 3.846153846
Glycine 2 3.846153846
Histidine 0 0
Isoleucine 4 7.692307692
Lysine 4 7.692307692
Leucine 0 0
Methionine 1 1.923076923
Asparagine 2 3.846153846
Proline 2 3.846153846
Glutamine 2 3.846153846
Arginine 5 9.615384615
Serine 3 5.769230769
Threonine 5 9.615384615
Valine 3 5.769230769
Tryptophan 0 0
Tyrosine 3 5.769230769