Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 3 1
Sequence
Reactive Loop      Linker
KACTLECGFASYVCPGPKSVALDFNSCHTCKKPLREGCKLYNRQGHQLCV
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-9 CTLEC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 30
Bond 2 7 - 38
Bond 3 14 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K A C T L E C G F A S Y V C P G P K S V A L D F N S C H T C K K P L R E G C K L Y N R Q G H Q L C V


Amino Acid Count Percentage
Alanine 3 6
Cysteine 7 14
Aspartic acid 1 2
Glutamic acid 2 4
Phenylalanine 2 4
Glycine 4 8
Histidine 2 4
Isoleucine 0 0
Lysine 5 10
Leucine 5 10
Methionine 0 0
Asparagine 2 4
Proline 3 6
Glutamine 2 4
Arginine 2 4
Serine 3 6
Threonine 2 4
Valine 3 6
Tryptophan 0 0
Tyrosine 2 4