Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 2 4 2
Sequence
Reactive Loop      Linker
TICTLECNTKAVYIRCLPDKKKTKIGSGGCTNCCVSRKRGCQLYDSNDRRLCA
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-9 CTLEC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 33
Bond 2 7 - 34
Bond 3 16 - 41
Bond 4 30 - 52
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
T I C T L E C N T K A V Y I R C L P D K K K T K I G S G G C T N C C V S R K R G C Q L Y D S N D R R L C A


Amino Acid Count Percentage
Alanine 2 3.773584906
Cysteine 8 15.09433962
Aspartic acid 3 5.660377358
Glutamic acid 1 1.886792453
Phenylalanine 0 0
Glycine 4 7.547169811
Histidine 0 0
Isoleucine 3 5.660377358
Lysine 6 11.32075472
Leucine 4 7.547169811
Methionine 0 0
Asparagine 3 5.660377358
Proline 1 1.886792453
Glutamine 1 1.886792453
Arginine 5 9.433962264
Serine 3 5.660377358
Threonine 5 9.433962264
Valine 2 3.773584906
Tryptophan 0 0
Tyrosine 2 3.773584906