Domain Type No. Of PIs No. of DS Bonds No. of Species
UnMapped 1 4 1
Sequence
Reactive Loop      Linker
KVCPQLCLGAEYMTCGSSDERLNPSCNCCLAPQGCTLYFSDGTSQYCA
REACTIVE LOOPS
Entry RCL Position Target Protease
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 26
Bond 2 7 - 29
Bond 3 15 - 35
Bond 4 28 - 47
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48
K V C P Q L C L G A E Y M T C G S S D E R L N P S C N C C L A P Q G C T L Y F S D G T S Q Y C A


Amino Acid Count Percentage