Domain Type No. Of PIs No. of DS Bonds No. of Species
H-L Type (Type-I) 1 4 1
Sequence
Reactive Loop      Linker
QICTNCCVGTMGCNYFSADGSFVCKGESDLRNPKDCPRNCDPRIDYRVCRRS
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 36 - 40 Trypsin
Linkers
Entry Linker Position Type
L-6 DLRNP 29 - 33 Type-I(DPRNP)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 40
Bond 2 6 - 24
Bond 3 7 - 36
Bond 4 13 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
Q I C T N C C V G T M G C N Y F S A D G S F V C K G E S D L R N P K D C P R N C D P R I D Y R V C R R S


Amino Acid Count Percentage
Alanine 1 1.923076923
Cysteine 8 15.38461538
Aspartic acid 5 9.615384615
Glutamic acid 1 1.923076923
Phenylalanine 2 3.846153846
Glycine 4 7.692307692
Histidine 0 0
Isoleucine 2 3.846153846
Lysine 2 3.846153846
Leucine 1 1.923076923
Methionine 1 1.923076923
Asparagine 4 7.692307692
Proline 3 5.769230769
Glutamine 1 1.923076923
Arginine 6 11.53846154
Serine 4 7.692307692
Threonine 2 3.846153846
Valine 3 5.769230769
Tryptophan 0 0
Tyrosine 2 3.846153846