PINIR_113 [A0A2S3HWR8]  : Uncharacterized protein

78Length

Panicum halliiSpecie

PAHAL_5G434500Gene Name

8119Mass

1Domain Count

Sequence :
    FASTA
MAASRVHITC ALLLIGAVLL GQGQEGMEGA VACPQYCLEV DYVTCPSSGA EKLPARCNCC MTPKGCTLHL 70
SDGTQQTC 78
SIGNAL PEPTIDE
SEQUENCE Position
MAASRVHITCALLLIGAVLLGQG
1 ↔ 23
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
31 - 78 48
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
5.136
-0.6 -5.7 -8.9
CROSS REFERENCES
REFERENCES
PubMed ID:    
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-33 CPQYC Unknown 34 - 38
GO TERMS
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-332 31 - 78 CPQYC 33 - 37 - H+L Type (Type-III)

VACPQYCLEVDYVTCPSSGAEKLPARCNCCMTPKGCTLHLSDGTQQTC
CPQYC
H+L Type (Type-III)
3,27 ; 7,15 ; 29,48 ; 30,36
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48
V A C P Q Y C L E V D Y V T C P S S G A E K L P A R C N C C M T P K G C T L H L S D G T Q Q T C



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-332
31 - 78 48
Amino Acid Count % by Frequency
Alanine 8 10.26
Cysteine 9 11.54
Aspartic acid 2 2.56
Glutamic acid 4 5.13
Phenylalanine 0 0
Glycine 8 10.26
Histidine 2 2.56
Isoleucine 2 2.56
Lysine 2 2.56
Leucine 9 11.54
Methionine 3 3.85
Asparagine 1 1.28
Proline 4 5.13
Glutamine 5 6.41
Arginine 2 2.56
Serine 4 5.13
Threonine 6 7.69
Valine 5 6.41
Tryptophan 0 0
Tyrosine 2 2.56