PINIR_13 [Q41489]  : Proteinase inhibitor type-2 (Proteinase inhibitor type II)

147Length

Solanum tuberosumSpecie

-Gene Name

15936Mass

2Domain Count

Sequence :
    FASTA
MAVHKEVSFV AYLLIVLGMF LYVDALGCTK ECGNLGFGIC PRSEGSPTNP ICINCCSGYK GCNYYSAFGR 70
FICEGESDPK NPKACPLNCD TNIAYSRCPR SEGKSLIYPT GCTTCCTGYK GCYYFGTNGK FVCEGESDEP 140
KPYMSTA 147
SIGNAL PEPTIDE
SEQUENCE Position
MAVHKEVSFVAYLLIVLGMFLYVDA
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
50 - 101 52
83 - 135 53
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
6.11299999999999
1.2 -6.8 -12.6
CROSS REFERENCES
REFERENCES
PubMed ID:    
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-2 CPLNC Chymotrypsin 86 - 90
RL-2 CPLNC Chymotrypsin 86 - 90
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-248 50 - 101 CPLNC 85 - 89 DPKNP 78 - 82 H-L Type (Type-I)
IRD-499 83 - 135 CPLNC 85 - 89 - H+L Type (Type-III)

PICINCCSGYKGCNYYSAFGRFICEGESDPKNPKACPLNCDTNIAYSRCPRS
CPLNC
DPKNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
P I C I N C C S G Y K G C N Y Y S A F G R F I C E G E S D P K N P K A C P L N C D T N I A Y S R C P R S



KACPLNCDTNIAYSRCPRSEGKSLIYPTGCTTCCTGYKGCYYFGTNGKFVCEG
CPLNC
H+L Type (Type-III)
3,33 ; 7,34 ; 16,30 ; 40,51
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
K A C P L N C D T N I A Y S R C P R S E G K S L I Y P T G C T T C C T G Y K G C Y Y F G T N G K F V C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-248
50 - 101 52
IRD-499
83 - 135 53
Amino Acid Count % by Frequency
Alanine 7 4.76
Cysteine 16 10.88
Aspartic acid 4 2.72
Glutamic acid 9 6.12
Phenylalanine 7 4.76
Glycine 17 11.56
Histidine 1 0.68
Isoleucine 7 4.76
Lysine 9 6.12
Leucine 8 5.44
Methionine 3 2.04
Asparagine 8 5.44
Proline 10 6.8
Glutamine 0 0
Arginine 4 2.72
Serine 11 7.48
Threonine 9 6.12
Valine 6 4.08
Tryptophan 0 0
Tyrosine 11 7.48