PINIR_178 [Q6H3X6]  : Protease inhibitor II (Proteinase inhibitor II)

148Length

Solanum lycopersicumSpecie

-Gene Name

16293Mass

3Domain Count

Sequence :
    FASTA
MAVHKEVNFV AYLLIVLGMF LYVDAKACTR ECGNLGFGIC PRSEGSPLNP ICINCCSGYK GCNYYNSFGK 70
FICEGESDPK RPNACTFNCD PNIAYSRCPR SQGKSLIYPT GCTTCCTGYK GCYYFGKDGK FVCEGESDEP 140
KANMYPVM 148
SIGNAL PEPTIDE
SEQUENCE Position
MAVHKEVNFVAYLLIVLGMFLYVDA
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
50 - 101 52
83 - 135 53
26 - 75 50
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
6.905
3.2 -4.8 -10.7
CROSS REFERENCES
REFERENCES
PubMed ID:     15191748    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-4 CTREC Trypsin 29 - 33
RL-7 CTFNC Chymotrypsin 86 - 90
RL-7 CTFNC Chymotrypsin 86 - 90
GO TERMS
Molecular Function Cellular Component Biological Process
peptidase activity (GO:0008233) serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
roots; stems ; leaves Wounding jasmonic acid; alpha-Linolenic acid expressed effectively in tobacco cells and the protein products showed insecticidal activity. 15191748
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-62 50 - 101 CTFNC 85 - 89 DPKRP 78 - 82 H-L Type (Type-I)
IRD-405 83 - 135 CTFNC 85 - 89 - H+L Type (Type-III)
IRD-456 26 - 75 CTREC 28 - 32 EGSPL 44 - 48 L-H Type (Type-II)

PICINCCSGYKGCNYYNSFGKFICEGESDPKRPNACTFNCDPNIAYSRCPRS
CTFNC
DPKRP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
P I C I N C C S G Y K G C N Y Y N S F G K F I C E G E S D P K R P N A C T F N C D P N I A Y S R C P R S



NACTFNCDPNIAYSRCPRSQGKSLIYPTGCTTCCTGYKGCYYFGKDGKFVCEG
CTFNC
H+L Type (Type-III)
3,33 ; 7,34 ; 16,30 ; 40,51
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
N A C T F N C D P N I A Y S R C P R S Q G K S L I Y P T G C T T C C T G Y K G C Y Y F G K D G K F V C E G



KACTRECGNLGFGICPRSEGSPLNPICINCCSGYKGCNYYNSFGKFICEG
CTREC
EGSPL
L-H Type (Type-II)
3,27 ; 7,31 ; 15,37 ; 30,48
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K A C T R E C G N L G F G I C P R S E G S P L N P I C I N C C S G Y K G C N Y Y N S F G K F I C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-62
50 - 101 52
IRD-405
83 - 135 53
IRD-456
26 - 75 50
Amino Acid Count % by Frequency
Alanine 7 4.73
Cysteine 16 10.81
Aspartic acid 5 3.38
Glutamic acid 8 5.41
Phenylalanine 8 5.41
Glycine 16 10.81
Histidine 1 0.68
Isoleucine 7 4.73
Lysine 10 6.76
Leucine 7 4.73
Methionine 4 2.7
Asparagine 10 6.76
Proline 10 6.76
Glutamine 1 0.68
Arginine 5 3.38
Serine 9 6.08
Threonine 6 4.05
Valine 7 4.73
Tryptophan 0 0
Tyrosine 11 7.43