PINIR_184 [Q1WL42]  : Trypsin proteinase inhibitor

338Length

Nicotiana linearisSpecie

PIGene Name

37519Mass

9Domain Count

Sequence :
    FASTA
MAVHRVSFLA VLLLFGMSLL VSNVEYADAK ACPRNCDPRI AYGVCPRSEE KEDNQICTNC CAGRKGCNYF 70
SADGTFVCEG ESDPKNPKAC PRNCDPRIAY RICRRSEEKK NDRICTNCCA GTKGCNYFSD DGTFVCEGES 140
DPRNPKACPR NCDTRIAYGI CRRSEETKND RICTNCCAGT KGCKYFSYDG NFVCEGESDP RNPKACPRNC 210
DGRIAYEICP RTEEKKNDRI CTNCCAGTKG CKYFSYDGTF VCEGESDPRN PKACPRNCDG RIAYGICPRT 280
EEKNNQICTN CCAGTKGCNY FSANGTFICE GESEYVSKVD EYVLEVENDL QKSRVAVS 338
SIGNAL PEPTIDE
SEQUENCE Position
MAVHRVSFLAVLLLFGMSLLVSNVEYADA
1 ↔ 29
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
55 - 106 52
113 - 164 52
171 - 222 52
229 - 280 52
146 - 196 51
30 - 80 51
262 - 311 50
88 - 138 51
204 - 254 51
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
6.394
3.7 -15.9 -30.3
CROSS REFERENCES
REFERENCES
PubMed ID:     16534618    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-1 CPRNC Trypsin 33 - 37
RL-1 CPRNC Trypsin 91 - 95
RL-1 CPRNC Trypsin 91 - 95
RL-1 CPRNC Trypsin 149 - 153
RL-1 CPRNC Trypsin 149 - 153
RL-1 CPRNC Trypsin 207 - 211
RL-1 CPRNC Trypsin 207 - 211
RL-1 CPRNC Trypsin 265 - 269
RL-1 CPRNC Trypsin 265 - 269
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-221 55 - 106 CPRNC 90 - 94 DPKNP 83 - 87 H-L Type (Type-I)
IRD-222 113 - 164 CPRNC 148 - 152 DPRNP 141 - 145 H-L Type (Type-I)
IRD-223 171 - 222 CPRNC 206 - 210 DPRNP 199 - 203 H-L Type (Type-I)
IRD-224 229 - 280 CPRNC 264 - 268 DPRNP 257 - 261 H-L Type (Type-I)
IRD-510 146 - 196 CPRNC 148 - 152 EETKN 165 - 169 L-H Type (Type-II)
IRD-535 30 - 80 CPRNC 32 - 36 EKEDN 50 - 54 L-H Type (Type-II)
IRD-589 262 - 311 CPRNC 264 - 268 EEKNN 281 - 285 L-H Type (Type-II)
IRD-650 88 - 138 CPRNC 90 - 94 EEKKN 107 - 111 L-H Type (Type-II)
IRD-651 204 - 254 CPRNC 206 - 210 EEKKN 223 - 227 L-H Type (Type-II)

QICTNCCAGRKGCNYFSADGTFVCEGESDPKNPKACPRNCDPRIAYRICRRS
CPRNC
DPKNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
Q I C T N C C A G R K G C N Y F S A D G T F V C E G E S D P K N P K A C P R N C D P R I A Y R I C R R S



RICTNCCAGTKGCNYFSDDGTFVCEGESDPRNPKACPRNCDTRIAYGICRRS
CPRNC
DPRNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G T K G C N Y F S D D G T F V C E G E S D P R N P K A C P R N C D T R I A Y G I C R R S



RICTNCCAGTKGCKYFSYDGNFVCEGESDPRNPKACPRNCDGRIAYEICPRT
CPRNC
DPRNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G T K G C K Y F S Y D G N F V C E G E S D P R N P K A C P R N C D G R I A Y E I C P R T



RICTNCCAGTKGCKYFSYDGTFVCEGESDPRNPKACPRNCDGRIAYGICPRT
CPRNC
DPRNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G T K G C K Y F S Y D G T F V C E G E S D P R N P K A C P R N C D G R I A Y G I C P R T



KACPRNCDTRIAYGICRRSEETKNDRICTNCCAGTKGCKYFSYDGNFVCEG
CPRNC
EETKN
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R N C D T R I A Y G I C R R S E E T K N D R I C T N C C A G T K G C K Y F S Y D G N F V C E G



KACPRNCDPRIAYGVCPRSEEKEDNQICTNCCAGRKGCNYFSADGTFVCEG
CPRNC
EKEDN
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R N C D P R I A Y G V C P R S E E K E D N Q I C T N C C A G R K G C N Y F S A D G T F V C E G



KACPRNCDGRIAYGICPRTEEKNNQICTNCCAGTKGCNYFSANGTFICEG
CPRNC
EEKNN
L-H Type (Type-II)
3,27 ; 7,31 ; 16,37 ; 30,48
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K A C P R N C D G R I A Y G I C P R T E E K N N Q I C T N C C A G T K G C N Y F S A N G T F I C E G



KACPRNCDPRIAYRICRRSEEKKNDRICTNCCAGTKGCNYFSDDGTFVCEG
CPRNC
EEKKN
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R N C D P R I A Y R I C R R S E E K K N D R I C T N C C A G T K G C N Y F S D D G T F V C E G



KACPRNCDGRIAYEICPRTEEKKNDRICTNCCAGTKGCKYFSYDGTFVCEG
CPRNC
EEKKN
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R N C D G R I A Y E I C P R T E E K K N D R I C T N C C A G T K G C K Y F S Y D G T F V C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-221
55 - 106 52
IRD-222
113 - 164 52
IRD-223
171 - 222 52
IRD-224
229 - 280 52
IRD-510
146 - 196 51
IRD-535
30 - 80 51
IRD-589
262 - 311 50
IRD-650
88 - 138 51
IRD-651
204 - 254 51
Amino Acid Count % by Frequency
Alanine 22 6.51
Cysteine 40 11.83
Aspartic acid 21 6.21
Glutamic acid 27 7.99
Phenylalanine 12 3.55
Glycine 26 7.69
Histidine 1 0.3
Isoleucine 15 4.44
Lysine 22 6.51
Leucine 8 2.37
Methionine 2 0.59
Asparagine 27 7.99
Proline 18 5.33
Glutamine 3 0.89
Arginine 27 7.99
Serine 19 5.62
Threonine 17 5.03
Valine 16 4.73
Tryptophan 0 0
Tyrosine 15 4.44