PINIR_233 [A0A097H1D6]  : PIN-II protein

154Length

Solanum tuberosumSpecie

PIN-IIGene Name

16660Mass

3Domain Count

Sequence :
    FASTA
MAVHKEVNFV AYLLIVLGLL VLVSAMEHVD AKACTLECGN LGFGICPRSE GSPENRICTN CCAGYKGCNY 70
YSANGAFICE GESDPKKPKA CPRNCDPHIA YSKCPRSEGK SLIYPTGCTT CCTGYKGCYY FGKNGKFVCE 140
GESDEPKANM YPAM 154
SIGNAL PEPTIDE
SEQUENCE Position
MAVHKEVNFVAYLLIVLGLLVLVSA
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
56 - 107 52
32 - 81 50
89 - 141 53
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
6.71399999999999
3.5 -5.8 -11.8
CROSS REFERENCES
REFERENCES
PubMed ID:     25260821    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-1 CPRNC Trypsin 92 - 96
RL-1 CPRNC Trypsin 92 - 96
RL-9 CTLEC Chymotrypsin 35 - 39
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-52 56 - 107 CPRNC 91 - 95 DPKKP 84 - 88 H-L Type (Type-I)
IRD-467 32 - 81 CTLEC 34 - 38 EGSPE 50 - 54 L-H Type (Type-II)
IRD-485 89 - 141 CPRNC 91 - 95 - H+L Type (Type-III)

RICTNCCAGYKGCNYYSANGAFICEGESDPKKPKACPRNCDPHIAYSKCPRS
CPRNC
DPKKP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G Y K G C N Y Y S A N G A F I C E G E S D P K K P K A C P R N C D P H I A Y S K C P R S



KACTLECGNLGFGICPRSEGSPENRICTNCCAGYKGCNYYSANGAFICEG
CTLEC
EGSPE
L-H Type (Type-II)
3,27 ; 7,31 ; 15,37 ; 30,48
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K A C T L E C G N L G F G I C P R S E G S P E N R I C T N C C A G Y K G C N Y Y S A N G A F I C E G



KACPRNCDPHIAYSKCPRSEGKSLIYPTGCTTCCTGYKGCYYFGKNGKFVCEG
CPRNC
H+L Type (Type-III)
3,33 ; 7,34 ; 16,30 ; 40,51
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
K A C P R N C D P H I A Y S K C P R S E G K S L I Y P T G C T T C C T G Y K G C Y Y F G K N G K F V C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-52
56 - 107 52
IRD-467
32 - 81 50
IRD-485
89 - 141 53
Amino Acid Count % by Frequency
Alanine 12 7.79
Cysteine 16 10.39
Aspartic acid 4 2.6
Glutamic acid 11 7.14
Phenylalanine 5 3.25
Glycine 16 10.39
Histidine 3 1.95
Isoleucine 6 3.9
Lysine 12 7.79
Leucine 9 5.84
Methionine 4 2.6
Asparagine 9 5.84
Proline 10 6.49
Glutamine 0 0
Arginine 4 2.6
Serine 9 5.84
Threonine 6 3.9
Valine 8 5.19
Tryptophan 0 0
Tyrosine 10 6.49