PINIR_299 [Q6JKN9]  : Proteinase inhibitor 2b

152Length

Solanum nigrumSpecie

PIN2bGene Name

16433Mass

3Domain Count

Sequence :
    FASTA
MAVHKEVSSL AYLLVLGLLF LFVSAIKHVD AKPCTRECGN LGYGICPRSE GSPENPICTN CCSGYKGCNY 70
YSANGTFICE GSSDPKNPNT CPLYCDGDIA YSKCPRSEGQ TIIYPTGCTT CCTGYKGCYY FSKEGEFVCE 140
GESIEPNVIS NQ 152
SIGNAL PEPTIDE
SEQUENCE Position
MAVHKEVSSLAYLLVLGLLFLFVSA
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
56 - 107 52
89 - 141 53
32 - 81 50
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
4.69
-2.1 -10.7 -16.5
CROSS REFERENCES
REFERENCES
PubMed ID:     15078438    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-27 CPLYC Chymotrypsin 92 - 96
RL-27 CPLYC Chymotrypsin 92 - 96
RL-4 CTREC Trypsin 35 - 39
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-272 56 - 107 CPLYC 91 - 95 DPKNP 84 - 88 H-L Type (Type-I)
IRD-299 89 - 141 CPLYC 91 - 95 - H+L Type (Type-III)
IRD-455 32 - 81 CTREC 34 - 38 EGSPE 50 - 54 L-H Type (Type-II)

PICTNCCSGYKGCNYYSANGTFICEGSSDPKNPNTCPLYCDGDIAYSKCPRS
CPLYC
DPKNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
P I C T N C C S G Y K G C N Y Y S A N G T F I C E G S S D P K N P N T C P L Y C D G D I A Y S K C P R S



NTCPLYCDGDIAYSKCPRSEGQTIIYPTGCTTCCTGYKGCYYFSKEGEFVCEG
CPLYC
H+L Type (Type-III)
3,33 ; 7,34 ; 16,30 ; 40,51
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
N T C P L Y C D G D I A Y S K C P R S E G Q T I I Y P T G C T T C C T G Y K G C Y Y F S K E G E F V C E G



KPCTRECGNLGYGICPRSEGSPENPICTNCCSGYKGCNYYSANGTFICEG
CTREC
EGSPE
L-H Type (Type-II)
3,27 ; 7,31 ; 15,37 ; 30,48
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K P C T R E C G N L G Y G I C P R S E G S P E N P I C T N C C S G Y K G C N Y Y S A N G T F I C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-272
56 - 107 52
IRD-299
89 - 141 53
IRD-455
32 - 81 50
Amino Acid Count % by Frequency
Alanine 6 3.95
Cysteine 16 10.53
Aspartic acid 4 2.63
Glutamic acid 11 7.24
Phenylalanine 5 3.29
Glycine 16 10.53
Histidine 2 1.32
Isoleucine 9 5.92
Lysine 8 5.26
Leucine 9 5.92
Methionine 1 0.66
Asparagine 9 5.92
Proline 10 6.58
Glutamine 2 1.32
Arginine 3 1.97
Serine 14 9.21
Threonine 9 5.92
Valine 7 4.61
Tryptophan 0 0
Tyrosine 11 7.24