PINIR_322 [A0A2G2ZAL9]  : Proteinase inhibitor PSI-1.2

109Length

Capsicum annuumSpecie

T459_17036Gene Name

11832Mass

1Domain Count

Sequence :
    FASTA
MQASSFHQGR HGLSLQGSII RHYGYAIVDS IFFVMDLSLE GIFLLGIEVE YGNAQKMCLQ VCDPEVAYMT 70
CPSSGDEKMS DVCVNCCTAA VGCKLFRSDG SFICTGTPE 109
SIGNAL PEPTIDE
SEQUENCE Position
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
56 - 106 51
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
4.342
-3.7 -9.3 -12.2
CROSS REFERENCES
REFERENCES
PubMed ID:     29089032    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-36 CLQVC Unknown 59 - 63
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-344 56 - 106 CLQVC 58 - 62 - H+L Type (Type-III)

KMCLQVCDPEVAYMTCPSSGDEKMSDVCVNCCTAAVGCKLFRSDGSFICTG
CLQVC
H+L Type (Type-III)
3,31 ; 7,32 ; 16,28 ; 38,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K M C L Q V C D P E V A Y M T C P S S G D E K M S D V C V N C C T A A V G C K L F R S D G S F I C T G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-344
56 - 106 51
Amino Acid Count % by Frequency
Alanine 6 5.5
Cysteine 8 7.34
Aspartic acid 6 5.5
Glutamic acid 6 5.5
Phenylalanine 6 5.5
Glycine 11 10.09
Histidine 3 2.75
Isoleucine 7 6.42
Lysine 3 2.75
Leucine 8 7.34
Methionine 5 4.59
Asparagine 2 1.83
Proline 3 2.75
Glutamine 5 4.59
Arginine 3 2.75
Serine 11 10.09
Threonine 4 3.67
Valine 8 7.34
Tryptophan 0 0
Tyrosine 4 3.67