PINIR_323 [A0A059PYZ4]  : Uncharacterized protein

83Length

Saccharum hybrid cultivar R570Specie

SHCRBa_119_J13_R_330Gene Name

9123Mass

1Domain Count

Sequence :
    FASTA
MASSTFFFPN IAGLMVIGCS IQTTEAWAWR ARARFCPMYC LDFEYMTCNS TGTKQLPGVC NCCLAAQKGC 70
TIHLRNGGVQ KCP 83
SIGNAL PEPTIDE
SEQUENCE Position
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
34 - 83 50
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
7.58799999999999
4.7 0.2 -2.9
CROSS REFERENCES
REFERENCES
PubMed ID:    
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-58 CPMYC Unknown 37 - 41
GO TERMS
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-372 34 - 83 CPMYC 36 - 40 - H+L Type (Type-III)

RFCPMYCLDFEYMTCNSTGTKQLPGVCNCCLAAQKGCTIHLRNGGVQKCP
CPMYC
H+L Type (Type-III)
3,30 ; 7,37 ; 15,49 ; 27,29
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
R F C P M Y C L D F E Y M T C N S T G T K Q L P G V C N C C L A A Q K G C T I H L R N G G V Q K C P



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-372
34 - 83 50
Amino Acid Count % by Frequency
Alanine 8 9.64
Cysteine 9 10.84
Aspartic acid 1 1.2
Glutamic acid 2 2.41
Phenylalanine 5 6.02
Glycine 7 8.43
Histidine 1 1.2
Isoleucine 4 4.82
Lysine 3 3.61
Leucine 5 6.02
Methionine 4 4.82
Asparagine 4 4.82
Proline 4 4.82
Glutamine 4 4.82
Arginine 4 4.82
Serine 4 4.82
Threonine 7 8.43
Valine 3 3.61
Tryptophan 2 2.41
Tyrosine 2 2.41