PINIR_329 [A0A2G2ZAE0]  : proteinase inhibitor type-2-like

84Length

Capsicum annuumSpecie

LOC107879783Gene Name

8812Mass

1Domain Count

Sequence :
    FASTA
MAFCKVGILS LLLVSGIFLL GIEVEFGNAQ KMCIQVCDPE VASMTCPSSG DEKINDVCVN CCTAAVGCKL 70
FRSDGSLICT GTLE 84
SIGNAL PEPTIDE
SEQUENCE Position
MAFCKVGILSLLLVSGIFLLGIEVEFGNA
1 ↔ 29
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
31 - 81 51
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
4.015
-3.6 -7.8 -11
CROSS REFERENCES
REFERENCES
PubMed ID:     24591624    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-38 CIQVC Unknown 34 - 38
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-348 31 - 81 CIQVC 33 - 37 - H+L Type (Type-III)

KMCIQVCDPEVASMTCPSSGDEKINDVCVNCCTAAVGCKLFRSDGSLICTG
CIQVC
H+L Type (Type-III)
3,32 ; 7,38 ; 16,28 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K M C I Q V C D P E V A S M T C P S S G D E K I N D V C V N C C T A A V G C K L F R S D G S L I C T G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-348
31 - 81 51
Amino Acid Count % by Frequency
Alanine 5 5.95
Cysteine 9 10.71
Aspartic acid 4 4.76
Glutamic acid 5 5.95
Phenylalanine 4 4.76
Glycine 8 9.52
Histidine 0 0
Isoleucine 6 7.14
Lysine 4 4.76
Leucine 9 10.71
Methionine 3 3.57
Asparagine 3 3.57
Proline 2 2.38
Glutamine 2 2.38
Arginine 1 1.19
Serine 7 8.33
Threonine 4 4.76
Valine 8 9.52
Tryptophan 0 0
Tyrosine 0 0