PINIR_335 [T1PZ85]  : Pin-II type proteinase inhibitor 33

262Length

Capsicum annuumSpecie

-Gene Name

28727Mass

7Domain Count

Sequence :
    FASTA
MAVPKEVSFL AFVLVLGILL LHVDAKACSE ENAENRICAN WCAGRKGCYY YSDDGTFICE GESDPNNPKP 70
CPRNCDTRIA YSICPRSEGN AENRICTNCC AGRKGCNYYS ADGTFICEGE SDPNNPKACP RYCDTRIAYS 140
KCPRSEGNAE NRICTNCCAG RKGCNYYSAD GTFICEGESD PNNPKACPRN CDTRIAYSKC PRSEGNAENR 210
LCTNCCAGRK GCNYYSADGT FICEGESDPN NPKACPRNCD PNIAYSLCLY EK 262
SIGNAL PEPTIDE
SEQUENCE Position
MAVPKEVSFLAFVLVLGILLLHVDA
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
36 - 87 52
152 - 203 52
210 - 261 52
94 - 145 52
185 - 235 51
69 - 119 51
127 - 177 51
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
5.244
0.1 -15.4 -26.7
CROSS REFERENCES
REFERENCES
PubMed ID:    
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-1 CPRNC Trypsin 72 - 76
RL-1 CPRNC Trypsin 72 - 76
RL-1 CPRNC Trypsin 188 - 192
RL-1 CPRNC Trypsin 188 - 192
RL-1 CPRNC Trypsin 246 - 250
RL-6 CPRYC Trypsin 130 - 134
RL-6 CPRYC Trypsin 130 - 134
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
Flowers,stems,fruit,leaves Wounding Insect Oral secretion 23153298
leaves Helicoverpa armigera Transgenic expression in tomato plant;IRD-9 and -12 exhibited strong inhibition (70–90%) of trypsin, chymotrypsin and HGP, while IRD-7 (40–70%) showed comparatively less inhibition 23261428
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-82 36 - 87 CPRNC 71 - 75 DPNNP 64 - 68 H-L Type (Type-I)
IRD-83 152 - 203 CPRNC 187 - 191 DPNNP 180 - 184 H-L Type (Type-I)
IRD-84 210 - 261 CPRNC 245 - 249 DPNNP 238 - 242 H-L Type (Type-I)
IRD-133 94 - 145 CPRYC 129 - 133 DPNNP 122 - 126 H-L Type (Type-I)
IRD-536 185 - 235 CPRNC 187 - 191 EGNAE 204 - 208 L-H Type (Type-II)
IRD-541 69 - 119 CPRNC 71 - 75 EGNAE 88 - 92 L-H Type (Type-II)
IRD-559 127 - 177 CPRYC 129 - 133 EGNAE 146 - 150 L-H Type (Type-II)

RICANWCAGRKGCYYYSDDGTFICEGESDPNNPKPCPRNCDTRIAYSICPRS
CPRNC
DPNNP
H-L Type (Type-I)
7,24 ; 13,40 ; 36,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C A N W C A G R K G C Y Y Y S D D G T F I C E G E S D P N N P K P C P R N C D T R I A Y S I C P R S



RICTNCCAGRKGCNYYSADGTFICEGESDPNNPKACPRNCDTRIAYSKCPRS
CPRNC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K A C P R N C D T R I A Y S K C P R S



RLCTNCCAGRKGCNYYSADGTFICEGESDPNNPKACPRNCDPNIAYSLCLYE
CPRNC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R L C T N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K A C P R N C D P N I A Y S L C L Y E



RICTNCCAGRKGCNYYSADGTFICEGESDPNNPKACPRYCDTRIAYSKCPRS
CPRYC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K A C P R Y C D T R I A Y S K C P R S



KACPRNCDTRIAYSKCPRSEGNAENRLCTNCCAGRKGCNYYSADGTFICEG
CPRNC
EGNAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R N C D T R I A Y S K C P R S E G N A E N R L C T N C C A G R K G C N Y Y S A D G T F I C E G



KPCPRNCDTRIAYSICPRSEGNAENRICTNCCAGRKGCNYYSADGTFICEG
CPRNC
EGNAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K P C P R N C D T R I A Y S I C P R S E G N A E N R I C T N C C A G R K G C N Y Y S A D G T F I C E G



KACPRYCDTRIAYSKCPRSEGNAENRICTNCCAGRKGCNYYSADGTFICEG
CPRYC
EGNAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R Y C D T R I A Y S K C P R S E G N A E N R I C T N C C A G R K G C N Y Y S A D G T F I C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-82
36 - 87 52
IRD-83
152 - 203 52
IRD-84
210 - 261 52
IRD-133
94 - 145 52
IRD-536
185 - 235 51
IRD-541
69 - 119 51
IRD-559
127 - 177 51
Amino Acid Count % by Frequency
Alanine 23 8.78
Cysteine 32 12.21
Aspartic acid 14 5.34
Glutamic acid 19 7.25
Phenylalanine 6 2.29
Glycine 20 7.63
Histidine 1 0.38
Isoleucine 13 4.96
Lysine 13 4.96
Leucine 9 3.44
Methionine 1 0.38
Asparagine 27 10.31
Proline 18 6.87
Glutamine 0 0
Arginine 18 6.87
Serine 17 6.49
Threonine 10 3.82
Valine 5 1.91
Tryptophan 1 0.38
Tyrosine 15 5.73