PINIR_347 [A0A1J3G2U3]  : Uncharacterized protein (Fragment)

90Length

Noccaea caerulescensSpecie

LC_TR4929_c0_g1_i1_g.17387Gene Name

9704Mass

1Domain Count

Sequence :
    FASTA
KMIIPLESMA TYKIWVMSLI IIGAVLVGGV IPGVTTTKTA IACPLYCLQV EYMTCLSSGD DKLPPRCNCC 70
LAPKNCTLHL SDSTSIHCNK 90
SIGNAL PEPTIDE
SEQUENCE Position
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
41 - 89 49
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
7.263
3.3 -1.4 -4.4
CROSS REFERENCES
REFERENCES
PubMed ID:    
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-27 CPLYC Chymotrypsin 44 - 48
GO TERMS
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-315 41 - 89 CPLYC 43 - 47 - H+L Type (Type-III)

IACPLYCLQVEYMTCLSSGDDKLPPRCNCCLAPKNCTLHLSDSTSIHCN
CPLYC
H+L Type (Type-III)
3,27 ; 7,15 ; 29,48 ; 30,36
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
I A C P L Y C L Q V E Y M T C L S S G D D K L P P R C N C C L A P K N C T L H L S D S T S I H C N



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-315
41 - 89 49
Amino Acid Count % by Frequency
Alanine 5 5.56
Cysteine 8 8.89
Aspartic acid 3 3.33
Glutamic acid 2 2.22
Phenylalanine 0 0
Glycine 5 5.56
Histidine 2 2.22
Isoleucine 9 10
Lysine 6 6.67
Leucine 10 11.11
Methionine 4 4.44
Asparagine 3 3.33
Proline 6 6.67
Glutamine 1 1.11
Arginine 1 1.11
Serine 7 7.78
Threonine 8 8.89
Valine 6 6.67
Tryptophan 1 1.11
Tyrosine 3 3.33