PINIR_350 [Q9SDL4]  : Uncharacterized protein CapinII

204Length

Capsicum annuumSpecie

CapinIIGene Name

22456Mass

5Domain Count

Sequence :
    FASTA
MAVHKEVSFL AFLLVLEILL LHVDAKACSE ENAENRICTN CCAGRKGCNY YSADGTFICE GESDPNNPKA 70
CPRYCDTRIA YSKCPRSEGN AENRICTNCC AGRKGCNYYS VIGTFICEGE SDPNNPKACP RNCDTRIAYS 140
KCPRSEGNAE NRLCTNCCAG RKVCNYYSAD GTFICEGESD PNNPKACPRN CDPNIAYSLC LYEK 204
SIGNAL PEPTIDE
SEQUENCE Position
MAVHKEVSFLAFLLVLEILLLHVDA
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
94 - 145 52
152 - 203 52
36 - 87 52
127 - 177 51
69 - 119 51
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
5.815
1.4 -11.5 -20.4
CROSS REFERENCES
REFERENCES
PubMed ID:    
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-1 CPRNC Trypsin 130 - 134
RL-1 CPRNC Trypsin 130 - 134
RL-1 CPRNC Trypsin 188 - 192
RL-6 CPRYC Trypsin 72 - 76
RL-6 CPRYC Trypsin 72 - 76
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
leaves Helicoverpa armigera Show 60-80% reduction in protease activity,Show activity for trypsin and chymotrypsin, 35% reduction in larval weight 15715970
Fruits Helicoverpa armigera Inhibition of 70% of the gut proteinase activity of Helicoverpa armigera,Larval and pupal growth reduction 17870253
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-105 94 - 145 CPRNC 129 - 133 DPNNP 122 - 126 H-L Type (Type-I)
IRD-106 152 - 203 CPRNC 187 - 191 DPNNP 180 - 184 H-L Type (Type-I)
IRD-133 36 - 87 CPRYC 71 - 75 DPNNP 64 - 68 H-L Type (Type-I)
IRD-550 127 - 177 CPRNC 129 - 133 EGNAE 146 - 150 L-H Type (Type-II)
IRD-563 69 - 119 CPRYC 71 - 75 EGNAE 88 - 92 L-H Type (Type-II)

RICTNCCAGRKGCNYYSVIGTFICEGESDPNNPKACPRNCDTRIAYSKCPRS
CPRNC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G R K G C N Y Y S V I G T F I C E G E S D P N N P K A C P R N C D T R I A Y S K C P R S



RLCTNCCAGRKVCNYYSADGTFICEGESDPNNPKACPRNCDPNIAYSLCLYE
CPRNC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R L C T N C C A G R K V C N Y Y S A D G T F I C E G E S D P N N P K A C P R N C D P N I A Y S L C L Y E



RICTNCCAGRKGCNYYSADGTFICEGESDPNNPKACPRYCDTRIAYSKCPRS
CPRYC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K A C P R Y C D T R I A Y S K C P R S



KACPRNCDTRIAYSKCPRSEGNAENRLCTNCCAGRKVCNYYSADGTFICEG
CPRNC
EGNAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R N C D T R I A Y S K C P R S E G N A E N R L C T N C C A G R K V C N Y Y S A D G T F I C E G



KACPRYCDTRIAYSKCPRSEGNAENRICTNCCAGRKGCNYYSVIGTFICEG
CPRYC
EGNAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R Y C D T R I A Y S K C P R S E G N A E N R I C T N C C A G R K G C N Y Y S V I G T F I C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-105
94 - 145 52
IRD-106
152 - 203 52
IRD-133
36 - 87 52
IRD-550
127 - 177 51
IRD-563
69 - 119 51
Amino Acid Count % by Frequency
Alanine 18 8.82
Cysteine 25 12.25
Aspartic acid 9 4.41
Glutamic acid 16 7.84
Phenylalanine 5 2.45
Glycine 13 6.37
Histidine 2 0.98
Isoleucine 10 4.9
Lysine 11 5.39
Leucine 10 4.9
Methionine 1 0.49
Asparagine 21 10.29
Proline 12 5.88
Glutamine 0 0
Arginine 13 6.37
Serine 13 6.37
Threonine 8 3.92
Valine 6 2.94
Tryptophan 0 0
Tyrosine 11 5.39