PINIR_356 [A0A1J3ILC6]  : Uncharacterized protein

97Length

Noccaea caerulescensSpecie

MP_TR3737_c0_g1_i1_g.10134Gene Name

10542Mass

1Domain Count

Sequence :
    FASTA
MYEPGEMKMI IPLESMATYK IWVMSLIIIG AVLVGGVIPG VTTTKTAIAC PLYCLQVEYM TCLSSGDDKL 70
PPRCNCCLAP KNCTLHLSDS TSIHCNK 97
SIGNAL PEPTIDE
SEQUENCE Position
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
48 - 96 49
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
6.439
1.5 -3.4 -6.4
CROSS REFERENCES
REFERENCES
PubMed ID:    
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-27 CPLYC Chymotrypsin 51 - 55
GO TERMS
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-315 48 - 96 CPLYC 50 - 54 - H+L Type (Type-III)

IACPLYCLQVEYMTCLSSGDDKLPPRCNCCLAPKNCTLHLSDSTSIHCN
CPLYC
H+L Type (Type-III)
3,27 ; 7,15 ; 29,48 ; 30,36
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
I A C P L Y C L Q V E Y M T C L S S G D D K L P P R C N C C L A P K N C T L H L S D S T S I H C N



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-315
48 - 96 49
Amino Acid Count % by Frequency
Alanine 5 5.15
Cysteine 8 8.25
Aspartic acid 3 3.09
Glutamic acid 4 4.12
Phenylalanine 0 0
Glycine 6 6.19
Histidine 2 2.06
Isoleucine 9 9.28
Lysine 6 6.19
Leucine 10 10.31
Methionine 6 6.19
Asparagine 3 3.09
Proline 7 7.22
Glutamine 1 1.03
Arginine 1 1.03
Serine 7 7.22
Threonine 8 8.25
Valine 6 6.19
Tryptophan 1 1.03
Tyrosine 4 4.12