PINIR_365 [A0A2I0XG42]  : Uncharacterized protein

168Length

Dendrobium catenatumSpecie

MA16_Dca017314Gene Name

18453Mass

1Domain Count

Sequence :
    FASTA
MKANSPYSEA GLANELKSSQ ILGKKNGQNS NLAATARRFL PSEIHLISVQ IKIKTKSFTE IIITRKDRYN 70
SASLYIQEAK LLTKNHQRRQ MGLPKPSLAL MLLLCGMILL SDLQEIKGAV ACPQYCLDVD YMTCASSGDE 140
KLAARCNCCL APKGCTLHLV DGQNVYCA 168
SIGNAL PEPTIDE
SEQUENCE Position
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
120 - 168 49
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
8.41
10.3 4 0.2
CROSS REFERENCES
REFERENCES
PubMed ID:     26754549    | 28902843    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-33 CPQYC Unknown 123 - 127
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
Genome assembly 26754549
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-330 120 - 168 CPQYC 122 - 126 - H+L Type (Type-III)

VACPQYCLDVDYMTCASSGDEKLAARCNCCLAPKGCTLHLVDGQNVYCA
CPQYC
H+L Type (Type-III)
3,27 ; 7,30 ; 15,36 ; 29,48
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
V A C P Q Y C L D V D Y M T C A S S G D E K L A A R C N C C L A P K G C T L H L V D G Q N V Y C A



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-330
120 - 168 49
Amino Acid Count % by Frequency
Alanine 16 9.52
Cysteine 9 5.36
Aspartic acid 6 3.57
Glutamic acid 7 4.17
Phenylalanine 2 1.19
Glycine 9 5.36
Histidine 3 1.79
Isoleucine 11 6.55
Lysine 14 8.33
Leucine 23 13.69
Methionine 5 2.98
Asparagine 9 5.36
Proline 6 3.57
Glutamine 9 5.36
Arginine 7 4.17
Serine 14 8.33
Threonine 7 4.17
Valine 5 2.98
Tryptophan 0 0
Tyrosine 6 3.57