PINIR_369 [A0A1U8GHX6]  : proteinase inhibitor type-2-like

230Length

Capsicum annuumSpecie

LOC107866020Gene Name

25453Mass

5Domain Count

Sequence :
    FASTA
MAAHKEVSFL TYLLVLGLMF LLVSASTKHD HDDDDDDHDH DHDHDDDDDD DHNPKPPKPC TKECGNFAYG 70
ICPRSEGSPK NPICTTCCAG YKGCYYYDAN GKLICEGQSD PRKPNKHCPR NCDPKIAYSK CPGRSEGKTI 140
IKPTGCTTCC TGYKGCYYYG KDDKFVCEGE SIEPRVCTQE CDPRVAYMTC PSTGSTKHTR ICVNCCTAKS 210
GCKLYDRNGS QLCTGDPKNH 230
SIGNAL PEPTIDE
SEQUENCE Position
MAAHKEVSFLTYLLVLGLMFLLVSA
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
144 - 193 50
82 - 134 53
175 - 225 51
58 - 107 50
116 - 169 54
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
5.899
2.4 -15.2 -24.4
CROSS REFERENCES
REFERENCES
PubMed ID:     24591624    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-1 CPRNC Trypsin 119 - 123
RL-1 CPRNC Trypsin 119 - 123
RL-10 CTKEC Trypsin 61 - 65
RL-18 CTQEC Unknown 178 - 182
RL-18 CTQEC Unknown 178 - 182
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-28 144 - 193 CTQEC 177 - 181 - H+L Type (Type-III)
IRD-50 82 - 134 CPRNC 118 - 122 DPRKP 110 - 114 H-L Type (Type-I)
IRD-280 175 - 225 CTQEC 177 - 181 - H+L Type (Type-III)
IRD-472 58 - 107 CTKEC 60 - 64 EGSPK 76 - 80 L-H Type (Type-II)
IRD-482 116 - 169 CPRNC 118 - 122 EGKTI 136 - 140 L-H Type (Type-II)

TGCTTCCTGYKGCYYYGKDDKFVCEGESIEPRVCTQECDPRVAYMTCPST
CTQEC
H+L Type (Type-III)
3,38 ; 6,24 ; 7,34 ; 13,47
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
T G C T T C C T G Y K G C Y Y Y G K D D K F V C E G E S I E P R V C T Q E C D P R V A Y M T C P S T



PICTTCCAGYKGCYYYDANGKLICEGQSDPRKPNKHCPRNCDPKIAYSKCPGR
CPRNC
DPRKP
H-L Type (Type-I)
3,41 ; 6,24 ; 7,37 ; 13,50
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
P I C T T C C A G Y K G C Y Y Y D A N G K L I C E G Q S D P R K P N K H C P R N C D P K I A Y S K C P G R



RVCTQECDPRVAYMTCPSTGSTKHTRICVNCCTAKSGCKLYDRNGSQLCTG
CTQEC
H+L Type (Type-III)
3,32 ; 7,38 ; 16,28 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
R V C T Q E C D P R V A Y M T C P S T G S T K H T R I C V N C C T A K S G C K L Y D R N G S Q L C T G



KPCTKECGNFAYGICPRSEGSPKNPICTTCCAGYKGCYYYDANGKLICEG
CTKEC
EGSPK
L-H Type (Type-II)
3,27 ; 7,31 ; 15,37 ; 30,48
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K P C T K E C G N F A Y G I C P R S E G S P K N P I C T T C C A G Y K G C Y Y Y D A N G K L I C E G



KHCPRNCDPKIAYSKCPGRSEGKTIIKPTGCTTCCTGYKGCYYYGKDDKFVCEG
CPRNC
EGKTI
L-H Type (Type-II)
3,34 ; 7,35 ; 16,31 ; 41,52
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54
K H C P R N C D P K I A Y S K C P G R S E G K T I I K P T G C T T C C T G Y K G C Y Y Y G K D D K F V C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-28
144 - 193 50
IRD-50
82 - 134 53
IRD-280
175 - 225 51
IRD-472
58 - 107 50
IRD-482
116 - 169 54
Amino Acid Count % by Frequency
Alanine 9 3.91
Cysteine 24 10.43
Aspartic acid 25 10.87
Glutamic acid 9 3.91
Phenylalanine 4 1.74
Glycine 19 8.26
Histidine 11 4.78
Isoleucine 8 3.48
Lysine 21 9.13
Leucine 10 4.35
Methionine 3 1.3
Asparagine 9 3.91
Proline 17 7.39
Glutamine 3 1.3
Arginine 8 3.48
Serine 13 5.65
Threonine 17 7.39
Valine 7 3.04
Tryptophan 0 0
Tyrosine 13 5.65