PINIR_374 [A0A2G2ZB86]  : Uncharacterized protein

57Length

Capsicum annuumSpecie

T459_17223Gene Name

6160Mass

1Domain Count

Sequence :
    FASTA
MERVEGKICP QICFDAAAYM MCPSSGTQKL APTCNCCLAP QGCSLYYADR TLICTST 57
SIGNAL PEPTIDE
SEQUENCE Position
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
7 - 56 50
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
5.602
0.1 -3.4 -6.1
CROSS REFERENCES
REFERENCES
PubMed ID:     29089032    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-40 CPQIC Unknown 10 - 14
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-354 7 - 56 CPQIC 9 - 13 - H+L Type (Type-III)

KICPQICFDAAAYMMCPSSGTQKLAPTCNCCLAPQGCSLYYADRTLICTS
CPQIC
H+L Type (Type-III)
3,28 ; 7,31 ; 16,37 ; 30,48
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K I C P Q I C F D A A A Y M M C P S S G T Q K L A P T C N C C L A P Q G C S L Y Y A D R T L I C T S



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-354
7 - 56 50
Amino Acid Count % by Frequency
Alanine 6 10.53
Cysteine 8 14.04
Aspartic acid 2 3.51
Glutamic acid 2 3.51
Phenylalanine 1 1.75
Glycine 3 5.26
Histidine 0 0
Isoleucine 3 5.26
Lysine 2 3.51
Leucine 4 7.02
Methionine 3 5.26
Asparagine 1 1.75
Proline 4 7.02
Glutamine 3 5.26
Arginine 2 3.51
Serine 4 7.02
Threonine 5 8.77
Valine 1 1.75
Tryptophan 0 0
Tyrosine 3 5.26