PINIR_379 [A0A2I4FPH4]  : LOW QUALITY PROTEIN: proteinase inhibitor type-2

87Length

Juglans regiaSpecie

LOC109000941Gene Name

9506Mass

1Domain Count

Sequence :
    FASTA
MAKYMSFGLT VLLLVYGAIL LGSINPQIKI FMIMSVKACP LYCLDVEYMT CQSSGEKKLN PSCNCCLAPK 70
NCTVHLVDGT SIYCKGN 87
SIGNAL PEPTIDE
SEQUENCE Position
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
37 - 86 50
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
7.437
3.7 -0.4 -3.5
CROSS REFERENCES
REFERENCES
PubMed ID:     27145194    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-27 CPLYC Chymotrypsin 40 - 44
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-305 37 - 86 CPLYC 39 - 43 - H+L Type (Type-III)

KACPLYCLDVEYMTCQSSGEKKLNPSCNCCLAPKNCTVHLVDGTSIYCKG
CPLYC
H+L Type (Type-III)
3,27 ; 7,30 ; 15,36 ; 29,48
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K A C P L Y C L D V E Y M T C Q S S G E K K L N P S C N C C L A P K N C T V H L V D G T S I Y C K G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-305
37 - 86 50
Amino Acid Count % by Frequency
Alanine 4 4.6
Cysteine 8 9.2
Aspartic acid 2 2.3
Glutamic acid 2 2.3
Phenylalanine 2 2.3
Glycine 6 6.9
Histidine 1 1.15
Isoleucine 6 6.9
Lysine 7 8.05
Leucine 11 12.64
Methionine 5 5.75
Asparagine 5 5.75
Proline 4 4.6
Glutamine 2 2.3
Arginine 0 0
Serine 7 8.05
Threonine 4 4.6
Valine 6 6.9
Tryptophan 0 0
Tyrosine 5 5.75