PINIR_383 [A0A1U8FAF4]  : proteinase inhibitor PSI-1.2-like

82Length

Capsicum annuumSpecie

LOC107855815Gene Name

8701Mass

1Domain Count

Sequence :
    FASTA
MATHRVVFLA LFLLSGILLL GSTVESAADK GCSRNCDTEV DYMVCPSGGE TITRNVCTNC CSAQKSCKLF 70
RSDGSVKCSG RS 82
SIGNAL PEPTIDE
SEQUENCE Position
MATHRVVFLALFLLSGILLLGSTVESAA
1 ↔ 28
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
30 - 80 51
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
7.40799999999999
2.8 -1.4 -4.3
CROSS REFERENCES
REFERENCES
PubMed ID:     24591624    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-22 CSRNC Trypsin 33 - 37
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-289 30 - 80 CSRNC 32 - 36 - H+L Type (Type-III)

KGCSRNCDTEVDYMVCPSGGETITRNVCTNCCSAQKSCKLFRSDGSVKCSG
CSRNC
H+L Type (Type-III)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K G C S R N C D T E V D Y M V C P S G G E T I T R N V C T N C C S A Q K S C K L F R S D G S V K C S G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-289
30 - 80 51
Amino Acid Count % by Frequency
Alanine 5 6.1
Cysteine 8 9.76
Aspartic acid 4 4.88
Glutamic acid 3 3.66
Phenylalanine 3 3.66
Glycine 7 8.54
Histidine 1 1.22
Isoleucine 2 2.44
Lysine 4 4.88
Leucine 8 9.76
Methionine 2 2.44
Asparagine 3 3.66
Proline 1 1.22
Glutamine 1 1.22
Arginine 5 6.1
Serine 11 13.41
Threonine 6 7.32
Valine 7 8.54
Tryptophan 0 0
Tyrosine 1 1.22