PINIR_385 [A0A1J3DYX7]  : Uncharacterized protein (Fragment)

84Length

Noccaea caerulescensSpecie

GA_TR9844_c18_g1_i1_g.32457Gene Name

9008Mass

1Domain Count

Sequence :
    FASTA
ESMATYKIWV MSLIIIGAVL VGGVIPGVTT TKTAIACPLY CLQVEYMTCL SSGDDKLPPR CNCCLAPKNC 70
TLHLSDSTSI HCNK 84
SIGNAL PEPTIDE
SEQUENCE Position
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
35 - 83 49
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
6.943
2.3 -2.4 -5.4
CROSS REFERENCES
REFERENCES
PubMed ID:    
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-27 CPLYC Chymotrypsin 38 - 42
GO TERMS
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-315 35 - 83 CPLYC 37 - 41 - H+L Type (Type-III)

IACPLYCLQVEYMTCLSSGDDKLPPRCNCCLAPKNCTLHLSDSTSIHCN
CPLYC
H+L Type (Type-III)
3,27 ; 7,15 ; 29,48 ; 30,36
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
I A C P L Y C L Q V E Y M T C L S S G D D K L P P R C N C C L A P K N C T L H L S D S T S I H C N



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-315
35 - 83 49
Amino Acid Count % by Frequency
Alanine 5 5.95
Cysteine 8 9.52
Aspartic acid 3 3.57
Glutamic acid 2 2.38
Phenylalanine 0 0
Glycine 5 5.95
Histidine 2 2.38
Isoleucine 7 8.33
Lysine 5 5.95
Leucine 9 10.71
Methionine 3 3.57
Asparagine 3 3.57
Proline 5 5.95
Glutamine 1 1.19
Arginine 1 1.19
Serine 7 8.33
Threonine 8 9.52
Valine 6 7.14
Tryptophan 1 1.19
Tyrosine 3 3.57