PINIR_389 [A0A2G3A0T9]  : Proteinase inhibitor type-2

228Length

Capsicum annuumSpecie

T459_09953Gene Name

25213Mass

5Domain Count

Sequence :
    FASTA
MAAHKEVSFL TYLLVLGLMF LLVSASTKHD HDDDDDHDHD HDHDDDDDDH NPKPPKSCTK ECGNFAYGIC 70
PRSEGSPKNP ICTTCCAGYK GCYYYDANGK LICEGQSDPR KPNKHCSRNC DPKIAYSKCP GRSEGKTIIK 140
PTGCTTCCTG YKGCYYYGKD DKFVCEGESI EPRVCTQECD PRVAYMTCPS TGSTKHTRIC VNCCTAKPGC 210
KLYDRNGSQL CTGDPKNH 228
SIGNAL PEPTIDE
SEQUENCE Position
MAAHKEVSFLTYLLVLGLMFLLVSA
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
142 - 191 50
80 - 132 53
173 - 223 51
56 - 105 50
114 - 167 54
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
6.154
4.4 -13.2 -22.4
CROSS REFERENCES
REFERENCES
PubMed ID:     29089032    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-10 CTKEC Trypsin 59 - 63
RL-18 CTQEC Unknown 176 - 180
RL-18 CTQEC Unknown 176 - 180
RL-22 CSRNC Trypsin 117 - 121
RL-22 CSRNC Trypsin 117 - 121
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-28 142 - 191 CTQEC 175 - 179 - H+L Type (Type-III)
IRD-67 80 - 132 CSRNC 116 - 120 DPRKP 108 - 112 H-L Type (Type-I)
IRD-282 173 - 223 CTQEC 175 - 179 - H+L Type (Type-III)
IRD-474 56 - 105 CTKEC 58 - 62 EGSPK 74 - 78 L-H Type (Type-II)
IRD-502 114 - 167 CSRNC 116 - 120 EGKTI 134 - 138 L-H Type (Type-II)

TGCTTCCTGYKGCYYYGKDDKFVCEGESIEPRVCTQECDPRVAYMTCPST
CTQEC
H+L Type (Type-III)
3,38 ; 6,24 ; 7,34 ; 13,47
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
T G C T T C C T G Y K G C Y Y Y G K D D K F V C E G E S I E P R V C T Q E C D P R V A Y M T C P S T



PICTTCCAGYKGCYYYDANGKLICEGQSDPRKPNKHCSRNCDPKIAYSKCPGR
CSRNC
DPRKP
H-L Type (Type-I)
3,41 ; 6,24 ; 7,37 ; 13,50
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
P I C T T C C A G Y K G C Y Y Y D A N G K L I C E G Q S D P R K P N K H C S R N C D P K I A Y S K C P G R



RVCTQECDPRVAYMTCPSTGSTKHTRICVNCCTAKPGCKLYDRNGSQLCTG
CTQEC
H+L Type (Type-III)
3,32 ; 7,38 ; 16,28 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
R V C T Q E C D P R V A Y M T C P S T G S T K H T R I C V N C C T A K P G C K L Y D R N G S Q L C T G



KSCTKECGNFAYGICPRSEGSPKNPICTTCCAGYKGCYYYDANGKLICEG
CTKEC
EGSPK
L-H Type (Type-II)
3,27 ; 7,31 ; 15,37 ; 30,48
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K S C T K E C G N F A Y G I C P R S E G S P K N P I C T T C C A G Y K G C Y Y Y D A N G K L I C E G



KHCSRNCDPKIAYSKCPGRSEGKTIIKPTGCTTCCTGYKGCYYYGKDDKFVCEG
CSRNC
EGKTI
L-H Type (Type-II)
3,34 ; 7,35 ; 16,31 ; 41,52
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54
K H C S R N C D P K I A Y S K C P G R S E G K T I I K P T G C T T C C T G Y K G C Y Y Y G K D D K F V C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-28
142 - 191 50
IRD-67
80 - 132 53
IRD-282
173 - 223 51
IRD-474
56 - 105 50
IRD-502
114 - 167 54
Amino Acid Count % by Frequency
Alanine 9 3.95
Cysteine 24 10.53
Aspartic acid 23 10.09
Glutamic acid 9 3.95
Phenylalanine 4 1.75
Glycine 19 8.33
Histidine 11 4.82
Isoleucine 8 3.51
Lysine 21 9.21
Leucine 10 4.39
Methionine 3 1.32
Asparagine 9 3.95
Proline 16 7.02
Glutamine 3 1.32
Arginine 8 3.51
Serine 14 6.14
Threonine 17 7.46
Valine 7 3.07
Tryptophan 0 0
Tyrosine 13 5.7