PINIR_390 [Q9M514]  : Uncharacterized protein (Fragment)

136Length

Capsicum annuumSpecie

-Gene Name

14936Mass

3Domain Count

Sequence :
    FASTA
KGNAENRICT NCCAGRKGCN YFSDIGTFIC EGESHPNNPK ACPRNCDTRI AYSKMSTFRR KTQKIAYAPI 70
AVQAVRVATN YSADGTFICE GESDPNNPKA CPRNCDQILP IHCVSMKNKS MNSVMLISVI CLGVYL 136
SIGNAL PEPTIDE
SEQUENCE Position
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
7 - 57 51
71 - 115 45
40 - 91 52
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
7.95799999999999
8.5 1.9 -2.6
CROSS REFERENCES
REFERENCES
PubMed ID:    
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-1 CPRNC Trypsin 43 - 47
RL-1 CPRNC Trypsin 43 - 47
RL-1 CPRNC Trypsin 102 - 106
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-49 7 - 57 CPRNC 42 - 46 HPNNP 35 - 39 H-L Type (Type-I)
IRD-120 71 - 115 CPRNC 101 - 105 DPNNP 94 - 98 H-L Type (Type-I)
IRD-693 40 - 91 CPRNC 42 - 46 - H+L Type (Type-III)

RICTNCCAGRKGCNYFSDIGTFICEGESHPNNPKACPRNCDTRIAYSKMST
CPRNC
HPNNP
H-L Type (Type-I)
36,40
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
R I C T N C C A G R K G C N Y F S D I G T F I C E G E S H P N N P K A C P R N C D T R I A Y S K M S T



AVQAVRVATNYSADGTFICEGESDPNNPKACPRNCDQILPIHCVS
CPRNC
DPNNP
H-L Type (Type-I)
19,43 ; 31,35
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45
A V Q A V R V A T N Y S A D G T F I C E G E S D P N N P K A C P R N C D Q I L P I H C V S



KACPRNCDTRIAYSKMSTFRRKTQKIAYAPIAVQAVRVATNYSADGTFICEG
CPRNC
H+L Type (Type-III)



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-49
7 - 57 51
IRD-120
71 - 115 45
IRD-693
40 - 91 52
Amino Acid Count % by Frequency
Alanine 11 8.09
Cysteine 12 8.82
Aspartic acid 5 3.68
Glutamic acid 5 3.68
Phenylalanine 4 2.94
Glycine 8 5.88
Histidine 2 1.47
Isoleucine 11 8.09
Lysine 9 6.62
Leucine 4 2.94
Methionine 4 2.94
Asparagine 13 9.56
Proline 8 5.88
Glutamine 3 2.21
Arginine 8 5.88
Serine 10 7.35
Threonine 7 5.15
Valine 7 5.15
Tryptophan 0 0
Tyrosine 5 3.68