PINIR_392 [A0A2G3AT01]  : Proteinase inhibitor type-2

331Length

Capsicum chinenseSpecie

BC332_33706Gene Name

36506Mass

4Domain Count

Sequence :
    FASTA
MAASKKTKDE QYQTTNEDSN ESIQPKIQRK QQTNTAAKKF GAPPRTPYGG ALPPVPPSEL TAEFDPRSRC 70
LLQNLQSTDM DRTSSXVTTC EIIWLRWLLA DMGVHISMPT PLHCDNKSVV QIAKNSVFHE RTKHIEIDCH 140
FTRHHLQLGT ISLPFVPSSL QIADLFTKAQ SASRFRFLCD KLSMLIAVAF SINSKYYRAD GTFICEGESD 210
PKNPKGCPRN CDPRIAYSKC PRSQGETLIY PTGCTTCCTG YKGCYYFGKD GKFVCEGEST EPKACTLECD 280
PRVAYMTCPS TGLAKIKDVC VNCCTAGEGC KLYGHNGSLL CTGESQSIST A 331
SIGNAL PEPTIDE
SEQUENCE Position
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
242 - 291 50
187 - 233 47
273 - 323 51
215 - 267 53
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
7.437
11.1 -4.4 -13.1
CROSS REFERENCES
REFERENCES
PubMed ID:     29089032    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-1 CPRNC Trypsin 218 - 222
RL-1 CPRNC Trypsin 218 - 222
RL-9 CTLEC Chymotrypsin 276 - 280
RL-9 CTLEC Chymotrypsin 276 - 280
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-10 242 - 291 CTLEC 275 - 279 - H+L Type (Type-III)
IRD-234 187 - 233 CPRNC 217 - 221 DPKNP 210 - 214 H-L Type (Type-I)
IRD-412 273 - 323 CTLEC 275 - 279 GLAKI 292 - 296 L-H Type (Type-II)
IRD-518 215 - 267 CPRNC 217 - 221 QGETL 234 - 238 L-H Type (Type-II)

TGCTTCCTGYKGCYYFGKDGKFVCEGESTEPKACTLECDPRVAYMTCPST
CTLEC
H+L Type (Type-III)
3,38 ; 6,24 ; 7,34 ; 13,47
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
T G C T T C C T G Y K G C Y Y F G K D G K F V C E G E S T E P K A C T L E C D P R V A Y M T C P S T



AVAFSINSKYYRADGTFICEGESDPKNPKGCPRNCDPRIAYSKCPRS
CPRNC
DPKNP
H-L Type (Type-I)
19,44 ; 31,35
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47
A V A F S I N S K Y Y R A D G T F I C E G E S D P K N P K G C P R N C D P R I A Y S K C P R S



KACTLECDPRVAYMTCPSTGLAKIKDVCVNCCTAGEGCKLYGHNGSLLCTG
CTLEC
GLAKI
L-H Type (Type-II)
3,32 ; 7,38 ; 16,28 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C T L E C D P R V A Y M T C P S T G L A K I K D V C V N C C T A G E G C K L Y G H N G S L L C T G



KGCPRNCDPRIAYSKCPRSQGETLIYPTGCTTCCTGYKGCYYFGKDGKFVCEG
CPRNC
QGETL
L-H Type (Type-II)
3,33 ; 7,34 ; 16,30 ; 40,51
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
K G C P R N C D P R I A Y S K C P R S Q G E T L I Y P T G C T T C C T G Y K G C Y Y F G K D G K F V C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-10
242 - 291 50
IRD-234
187 - 233 47
IRD-412
273 - 323 51
IRD-518
215 - 267 53
Amino Acid Count % by Frequency
Alanine 21 6.34
Cysteine 22 6.65
Aspartic acid 16 4.83
Glutamic acid 17 5.14
Phenylalanine 12 3.63
Glycine 21 6.34
Histidine 8 2.42
Isoleucine 17 5.14
Lysine 23 6.95
Leucine 23 6.95
Methionine 6 1.81
Asparagine 11 3.32
Proline 22 6.65
Glutamine 14 4.23
Arginine 15 4.53
Serine 28 8.46
Threonine 29 8.76
Valine 12 3.63
Tryptophan 2 0.6
Tyrosine 11 3.32