PINIR_395 [A0A2G3A0S4]  : Wound-induced proteinase inhibitor 2

378Length

Capsicum annuumSpecie

T459_09948Gene Name

41283Mass

11Domain Count

Sequence :
    FASTA
MAVPKEVCFL ASLLVLGILL LHVDAKACSQ RNAKEPICTN CCAGRKGCNY YSADGTFICE GESDPNNPKP 70
CTLNCDPRIF YSKCPRSEGN AENRICTNCC AGRKGCNYYS ADGTFICEGE SDPNNPKPCT LNCDPRIFYS 140
KCPRSEGNAE NRICTNCCAG RKGCNYYSAD GTFICEGESD PNNPKPCTLN CDPRIFYSKC PRSEGNAENR 210
ICTNCCAGRK GCNYYSADGT FICEGESDPN NPKPCPRNCD TRIAYSKCPR SEGNAENRIC INCCAGRKGC 280
NYYSADGTFI CEGESDPNNP KPCTLNCDPR IFYSKCPRSE ASAEQPICTN CCAGLKGCNY YNADGTFICE 350
GESDPNHPKA CPKNCDPNIA YSLCLYEK 378
SIGNAL PEPTIDE
SEQUENCE Position
MAVPKEVCFLASLLVLGILLLHVDA
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
210 - 261 52
36 - 87 52
94 - 145 52
152 - 203 52
268 - 319 52
326 - 377 52
301 - 351 51
243 - 293 51
185 - 235 51
69 - 119 51
127 - 177 51
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
5.78799999999999
2 -22 -39.7
CROSS REFERENCES
REFERENCES
PubMed ID:     29089032    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-1 CPRNC Trypsin 246 - 250
RL-1 CPRNC Trypsin 246 - 250
RL-11 CPKNC Trypsin 362 - 366
RL-3 CTLNC Chymotrypsin 72 - 76
RL-3 CTLNC Chymotrypsin 72 - 76
RL-3 CTLNC Chymotrypsin 130 - 134
RL-3 CTLNC Chymotrypsin 130 - 134
RL-3 CTLNC Chymotrypsin 188 - 192
RL-3 CTLNC Chymotrypsin 188 - 192
RL-3 CTLNC Chymotrypsin 304 - 308
RL-3 CTLNC Chymotrypsin 304 - 308
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-78 210 - 261 CPRNC 245 - 249 DPNNP 238 - 242 H-L Type (Type-I)
IRD-121 36 - 87 CTLNC 71 - 75 DPNNP 64 - 68 H-L Type (Type-I)
IRD-122 94 - 145 CTLNC 129 - 133 DPNNP 122 - 126 H-L Type (Type-I)
IRD-122 152 - 203 CTLNC 187 - 191 DPNNP 180 - 184 H-L Type (Type-I)
IRD-123 268 - 319 CTLNC 303 - 307 DPNNP 296 - 300 H-L Type (Type-I)
IRD-143 326 - 377 CPKNC 361 - 365 DPNHP 354 - 358 H-L Type (Type-I)
IRD-444 301 - 351 CTLNC 303 - 307 EASAE 320 - 324 L-H Type (Type-II)
IRD-534 243 - 293 CPRNC 245 - 249 EGNAE 262 - 266 L-H Type (Type-II)
IRD-551 185 - 235 CTLNC 187 - 191 EGNAE 204 - 208 L-H Type (Type-II)
IRD-551 69 - 119 CTLNC 71 - 75 EGNAE 88 - 92 L-H Type (Type-II)
IRD-551 127 - 177 CTLNC 129 - 133 EGNAE 146 - 150 L-H Type (Type-II)

RICTNCCAGRKGCNYYSADGTFICEGESDPNNPKPCPRNCDTRIAYSKCPRS
CPRNC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K P C P R N C D T R I A Y S K C P R S



PICTNCCAGRKGCNYYSADGTFICEGESDPNNPKPCTLNCDPRIFYSKCPRS
CTLNC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
P I C T N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K P C T L N C D P R I F Y S K C P R S



RICTNCCAGRKGCNYYSADGTFICEGESDPNNPKPCTLNCDPRIFYSKCPRS
CTLNC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K P C T L N C D P R I F Y S K C P R S



RICTNCCAGRKGCNYYSADGTFICEGESDPNNPKPCTLNCDPRIFYSKCPRS
CTLNC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K P C T L N C D P R I F Y S K C P R S



RICINCCAGRKGCNYYSADGTFICEGESDPNNPKPCTLNCDPRIFYSKCPRS
CTLNC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C I N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K P C T L N C D P R I F Y S K C P R S



PICTNCCAGLKGCNYYNADGTFICEGESDPNHPKACPKNCDPNIAYSLCLYE
CPKNC
DPNHP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
P I C T N C C A G L K G C N Y Y N A D G T F I C E G E S D P N H P K A C P K N C D P N I A Y S L C L Y E



KPCTLNCDPRIFYSKCPRSEASAEQPICTNCCAGLKGCNYYNADGTFICEG
CTLNC
EASAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K P C T L N C D P R I F Y S K C P R S E A S A E Q P I C T N C C A G L K G C N Y Y N A D G T F I C E G



KPCPRNCDTRIAYSKCPRSEGNAENRICINCCAGRKGCNYYSADGTFICEG
CPRNC
EGNAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K P C P R N C D T R I A Y S K C P R S E G N A E N R I C I N C C A G R K G C N Y Y S A D G T F I C E G



KPCTLNCDPRIFYSKCPRSEGNAENRICTNCCAGRKGCNYYSADGTFICEG
CTLNC
EGNAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K P C T L N C D P R I F Y S K C P R S E G N A E N R I C T N C C A G R K G C N Y Y S A D G T F I C E G



KPCTLNCDPRIFYSKCPRSEGNAENRICTNCCAGRKGCNYYSADGTFICEG
CTLNC
EGNAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K P C T L N C D P R I F Y S K C P R S E G N A E N R I C T N C C A G R K G C N Y Y S A D G T F I C E G



KPCTLNCDPRIFYSKCPRSEGNAENRICTNCCAGRKGCNYYSADGTFICEG
CTLNC
EGNAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K P C T L N C D P R I F Y S K C P R S E G N A E N R I C T N C C A G R K G C N Y Y S A D G T F I C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-78
210 - 261 52
IRD-121
36 - 87 52
IRD-122
94 - 145 52
IRD-122
152 - 203 52
IRD-123
268 - 319 52
IRD-143
326 - 377 52
IRD-444
301 - 351 51
IRD-534
243 - 293 51
IRD-551
185 - 235 51
IRD-551
69 - 119 51
IRD-551
127 - 177 51
Amino Acid Count % by Frequency
Alanine 26 6.88
Cysteine 50 13.23
Aspartic acid 19 5.03
Glutamic acid 25 6.61
Phenylalanine 11 2.91
Glycine 29 7.67
Histidine 2 0.53
Isoleucine 20 5.29
Lysine 22 5.82
Leucine 14 3.7
Methionine 1 0.26
Asparagine 40 10.58
Proline 32 8.47
Glutamine 2 0.53
Arginine 21 5.56
Serine 25 6.61
Threonine 16 4.23
Valine 4 1.06
Tryptophan 0 0
Tyrosine 19 5.03