PINIR_408 [A0A1U8FXN6]  : proteinase inhibitor type-2-like

199Length

Capsicum annuumSpecie

LOC107862771Gene Name

21279Mass

5Domain Count

Sequence :
    FASTA
MAVHKEVSFL GYLLVLGIFL HHVDGKACTR ECGNLGYGIC PRSEGSAEEP ICTNCCAGYK GCKYYSADGT 70
FICEGESDPK NPKGCPRNCD PRIAYSKCPR SQGETLIYPT GCTTCCTGYK GCYYFGKDGK FLCEGESTEP 140
KACTLECDPR VAYMTCPSTG LAKIKDVCVN CCTAGEGCKL YGHNGSLLCT GESQSISTA 199
SIGNAL PEPTIDE
SEQUENCE Position
MAVHKEVSFLGYLLVLGIFLHHVDG
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
110 - 159 50
50 - 101 52
141 - 191 51
26 - 75 50
83 - 135 53
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
6.053
2.3 -11.1 -19.9
CROSS REFERENCES
REFERENCES
PubMed ID:     24591624    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-1 CPRNC Trypsin 86 - 90
RL-1 CPRNC Trypsin 86 - 90
RL-4 CTREC Trypsin 29 - 33
RL-9 CTLEC Chymotrypsin 144 - 148
RL-9 CTLEC Chymotrypsin 144 - 148
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-12 110 - 159 CTLEC 143 - 147 - H+L Type (Type-III)
IRD-232 50 - 101 CPRNC 85 - 89 DPKNP 78 - 82 H-L Type (Type-I)
IRD-412 141 - 191 CTLEC 143 - 147 GLAKI 160 - 164 L-H Type (Type-II)
IRD-451 26 - 75 CTREC 28 - 32 EGSAE 44 - 48 L-H Type (Type-II)
IRD-519 83 - 135 CPRNC 85 - 89 QGETL 102 - 106 L-H Type (Type-II)

TGCTTCCTGYKGCYYFGKDGKFLCEGESTEPKACTLECDPRVAYMTCPST
CTLEC
H+L Type (Type-III)
3,38 ; 6,24 ; 7,34 ; 13,47
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
T G C T T C C T G Y K G C Y Y F G K D G K F L C E G E S T E P K A C T L E C D P R V A Y M T C P S T



PICTNCCAGYKGCKYYSADGTFICEGESDPKNPKGCPRNCDPRIAYSKCPRS
CPRNC
DPKNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
P I C T N C C A G Y K G C K Y Y S A D G T F I C E G E S D P K N P K G C P R N C D P R I A Y S K C P R S



KACTLECDPRVAYMTCPSTGLAKIKDVCVNCCTAGEGCKLYGHNGSLLCTG
CTLEC
GLAKI
L-H Type (Type-II)
3,32 ; 7,38 ; 16,28 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C T L E C D P R V A Y M T C P S T G L A K I K D V C V N C C T A G E G C K L Y G H N G S L L C T G



KACTRECGNLGYGICPRSEGSAEEPICTNCCAGYKGCKYYSADGTFICEG
CTREC
EGSAE
L-H Type (Type-II)
3,27 ; 7,31 ; 15,37 ; 30,48
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K A C T R E C G N L G Y G I C P R S E G S A E E P I C T N C C A G Y K G C K Y Y S A D G T F I C E G



KGCPRNCDPRIAYSKCPRSQGETLIYPTGCTTCCTGYKGCYYFGKDGKFLCEG
CPRNC
QGETL
L-H Type (Type-II)
3,33 ; 7,34 ; 16,30 ; 40,51
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
K G C P R N C D P R I A Y S K C P R S Q G E T L I Y P T G C T T C C T G Y K G C Y Y F G K D G K F L C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-12
110 - 159 50
IRD-232
50 - 101 52
IRD-412
141 - 191 51
IRD-451
26 - 75 50
IRD-519
83 - 135 53
Amino Acid Count % by Frequency
Alanine 11 5.53
Cysteine 24 12.06
Aspartic acid 7 3.52
Glutamic acid 14 7.04
Phenylalanine 5 2.51
Glycine 25 12.56
Histidine 4 2.01
Isoleucine 8 4.02
Lysine 14 7.04
Leucine 13 6.53
Methionine 2 1.01
Asparagine 6 3.02
Proline 11 5.53
Glutamine 2 1.01
Arginine 6 3.02
Serine 13 6.53
Threonine 15 7.54
Valine 7 3.52
Tryptophan 0 0
Tyrosine 12 6.03