PINIR_411 [A0A2G3AW67]  : Proteinase inhibitor type-2

200Length

Capsicum chinenseSpecie

BC332_32643Gene Name

21575Mass

5Domain Count

Sequence :
    FASTA
MAVHKEVSFL AFLLVLGIFL LHADAKACTK ECGNFAYGIC PRSEGSAKEP ICTNCCSGYK GCNYYSADGT 70
FVCEGEFDPK EGPKACPANC DPRIAYSKCP RSQGRRIHYP TGCTNCCTGY KGCYYFGKDG KFVCEGESTE 140
PKKCPAICII DAYMTCPSSG SVKIKVHCGN CCTLREGCKL YRKDGSLICT GEPQISISAA 200
SIGNAL PEPTIDE
SEQUENCE Position
MAVHKEVSFLAFLLVLGIFLLHADA
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
111 - 159 49
50 - 102 53
142 - 191 50
84 - 136 53
26 - 75 50
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
7.197
8.2 -5.2 -14.1
CROSS REFERENCES
REFERENCES
PubMed ID:     29089032    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-10 CTKEC Trypsin 29 - 33
RL-21 CPAIC Elastase 145 - 149
RL-21 CPAIC Elastase 145 - 149
RL-29 CPANC Elastase 87 - 91
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-36 111 - 159 CPAIC 144 - 148 - H+L Type (Type-III)
IRD-44 50 - 102 CPANC 86 - 90 DPKEGP 78 - 83 H-L Type (Type-I)
IRD-287 142 - 191 CPAIC 144 - 148 - H+L Type (Type-III)
IRD-317 84 - 136 CPANC 86 - 90 - H+L Type (Type-III)
IRD-421 26 - 75 CTKEC 28 - 32 EGSAK 44 - 48 L-H Type (Type-II)

TGCTNCCTGYKGCYYFGKDGKFVCEGESTEPKKCPAICIIDAYMTCPSS
CPAIC
H+L Type (Type-III)
3,38 ; 6,24 ; 7,34 ; 13,46
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
T G C T N C C T G Y K G C Y Y F G K D G K F V C E G E S T E P K K C P A I C I I D A Y M T C P S S



PICTNCCSGYKGCNYYSADGTFVCEGEFDPKEGPKACPANCDPRIAYSKCPRS
CPANC
DPKEGP
H-L Type (Type-I)
3,41 ; 6,24 ; 7,37 ; 13,50
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
P I C T N C C S G Y K G C N Y Y S A D G T F V C E G E F D P K E G P K A C P A N C D P R I A Y S K C P R S



KKCPAICIIDAYMTCPSSGSVKIKVHCGNCCTLREGCKLYRKDGSLICTG
CPAIC
H+L Type (Type-III)
3,31 ; 7,37 ; 15,27 ; 30,48
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K K C P A I C I I D A Y M T C P S S G S V K I K V H C G N C C T L R E G C K L Y R K D G S L I C T G



KACPANCDPRIAYSKCPRSQGRRIHYPTGCTNCCTGYKGCYYFGKDGKFVCEG
CPANC
H+L Type (Type-III)
3,33 ; 7,34 ; 16,30 ; 40,51
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
K A C P A N C D P R I A Y S K C P R S Q G R R I H Y P T G C T N C C T G Y K G C Y Y F G K D G K F V C E G



KACTKECGNFAYGICPRSEGSAKEPICTNCCSGYKGCNYYSADGTFVCEG
CTKEC
EGSAK
L-H Type (Type-II)
3,27 ; 7,31 ; 15,37 ; 30,48
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K A C T K E C G N F A Y G I C P R S E G S A K E P I C T N C C S G Y K G C N Y Y S A D G T F V C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-36
111 - 159 49
IRD-44
50 - 102 53
IRD-287
142 - 191 50
IRD-317
84 - 136 53
IRD-421
26 - 75 50
Amino Acid Count % by Frequency
Alanine 15 7.5
Cysteine 24 12
Aspartic acid 7 3.5
Glutamic acid 12 6
Phenylalanine 8 4
Glycine 21 10.5
Histidine 4 2
Isoleucine 12 6
Lysine 17 8.5
Leucine 9 4.5
Methionine 2 1
Asparagine 6 3
Proline 12 6
Glutamine 2 1
Arginine 7 3.5
Serine 14 7
Threonine 10 5
Valine 7 3.5
Tryptophan 0 0
Tyrosine 11 5.5