PINIR_412 [A0A2G3A0X2]  : Proteinase inhibitor type-2

200Length

Capsicum annuumSpecie

T459_09952Gene Name

21691Mass

5Domain Count

Sequence :
    FASTA
MAVPKEVSFP ACLLVLGMFV IANAVELGDD IKVCTMECGN FAYGICPRSE GSPICTNCCS GYKGCNYYSA 70
NGTFICEGRS DPRKTNICTQ HCDPRVAYSK CPRSGGNTII KHTECTTCCT GYKGCYYFGH DGKFVCEGQS 140
SEPRACTLEC DPKVAYMTCP SSGSTKLTRI CVNCCTARVQ GCKLYGPDEF LLCTGDPRNY 200
SIGNAL PEPTIDE
SEQUENCE Position
MAVPKEVSFPACLLVLGMFVIANA
1 ↔ 24
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
113 - 162 50
53 - 104 52
86 - 138 53
144 - 195 52
32 - 78 47
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
6.786
4.5 -8.5 -17.4
CROSS REFERENCES
REFERENCES
PubMed ID:     29089032    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-19 CTMEC Unknown 35 - 39
RL-25 CTQHC Unknown 89 - 93
RL-25 CTQHC Unknown 89 - 93
RL-9 CTLEC Chymotrypsin 147 - 151
RL-9 CTLEC Chymotrypsin 147 - 151
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-15 113 - 162 CTLEC 146 - 150 - H+L Type (Type-III)
IRD-43 53 - 104 CTQHC 88 - 92 DPRKT 81 - 85 H-L Type (Type-I)
IRD-296 86 - 138 CTQHC 88 - 92 GGNTI 105 - 109 L-H Type (Type-II)
IRD-416 144 - 195 CTLEC 146 - 150 GSTKL 163 - 167 L-H Type (Type-II)
IRD-692 32 - 78 CTMEC 34 - 38 - H+L Type (Type-III)

TECTTCCTGYKGCYYFGHDGKFVCEGQSSEPRACTLECDPKVAYMTCPSS
CTLEC
H+L Type (Type-III)
3,38 ; 6,24 ; 7,34 ; 13,47
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
T E C T T C C T G Y K G C Y Y F G H D G K F V C E G Q S S E P R A C T L E C D P K V A Y M T C P S S



PICTNCCSGYKGCNYYSANGTFICEGRSDPRKTNICTQHCDPRVAYSKCPRS
CTQHC
DPRKT
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
P I C T N C C S G Y K G C N Y Y S A N G T F I C E G R S D P R K T N I C T Q H C D P R V A Y S K C P R S



NICTQHCDPRVAYSKCPRSGGNTIIKHTECTTCCTGYKGCYYFGHDGKFVCEG
CTQHC
GGNTI
L-H Type (Type-II)
3,33 ; 7,34 ; 16,30 ; 40,51
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
N I C T Q H C D P R V A Y S K C P R S G G N T I I K H T E C T T C C T G Y K G C Y Y F G H D G K F V C E G



RACTLECDPKVAYMTCPSSGSTKLTRICVNCCTARVQGCKLYGPDEFLLCTG
CTLEC
GSTKL
L-H Type (Type-II)
3,28 ; 7,32 ; 16,39 ; 31,50
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R A C T L E C D P K V A Y M T C P S S G S T K L T R I C V N C C T A R V Q G C K L Y G P D E F L L C T G



KVCTMECGNFAYGICPRSEGSPICTNCCSGYKGCNYYSANGTFICEG
CTMEC
H+L Type (Type-III)
3,28 ; 7,34 ; 15,24 ; 27,45
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47
K V C T M E C G N F A Y G I C P R S E G S P I C T N C C S G Y K G C N Y Y S A N G T F I C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-15
113 - 162 50
IRD-43
53 - 104 52
IRD-296
86 - 138 53
IRD-416
144 - 195 52
IRD-692
32 - 78 47
Amino Acid Count % by Frequency
Alanine 10 5
Cysteine 25 12.5
Aspartic acid 8 4
Glutamic acid 10 5
Phenylalanine 7 3.5
Glycine 20 10
Histidine 3 1.5
Isoleucine 9 4.5
Lysine 11 5.5
Leucine 9 4.5
Methionine 4 2
Asparagine 9 4.5
Proline 12 6
Glutamine 3 1.5
Arginine 9 4.5
Serine 13 6.5
Threonine 16 8
Valine 11 5.5
Tryptophan 0 0
Tyrosine 11 5.5