PINIR_414 [T1PZ63]  : Pin-II type proteinase inhibitor 26

146Length

Capsicum annuumSpecie

-Gene Name

15820Mass

3Domain Count

Sequence :
    FASTA
MAVPKEVSFL ASLLVLGILL LHVDAKACSQ RNAKEPICTN CCAGRKGCNY YSADGTFICE GESDPNNPKP 70
CTLNCDPRIF YSKCPRSEAS AEQPICTNCC AGLKGCNYYN ADGTFICEGE SDPNHPKACP KNCDPNIAYS 140
LCLYEK 146
SIGNAL PEPTIDE
SEQUENCE Position
MAVPKEVSFLASLLVLGILLLHVDA
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
36 - 87 52
94 - 145 52
69 - 119 51
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
5.325
-0.2 -9.2 -15.4
CROSS REFERENCES
REFERENCES
PubMed ID:    
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-11 CPKNC Trypsin 130 - 134
RL-3 CTLNC Chymotrypsin 72 - 76
RL-3 CTLNC Chymotrypsin 72 - 76
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
Flowers,stems,fruit,leaves Wounding Insect Oral secretion 23153298
leaves Helicoverpa armigera Transgenic expression in tomato plant;IRD-9 and -12 exhibited strong inhibition (70–90%) of trypsin, chymotrypsin and HGP, while IRD-7 (40–70%) showed comparatively less inhibition 23261428
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-121 36 - 87 CTLNC 71 - 75 DPNNP 64 - 68 H-L Type (Type-I)
IRD-143 94 - 145 CPKNC 129 - 133 DPNHP 122 - 126 H-L Type (Type-I)
IRD-444 69 - 119 CTLNC 71 - 75 EASAE 88 - 92 L-H Type (Type-II)

PICTNCCAGRKGCNYYSADGTFICEGESDPNNPKPCTLNCDPRIFYSKCPRS
CTLNC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
P I C T N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K P C T L N C D P R I F Y S K C P R S



PICTNCCAGLKGCNYYNADGTFICEGESDPNHPKACPKNCDPNIAYSLCLYE
CPKNC
DPNHP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
P I C T N C C A G L K G C N Y Y N A D G T F I C E G E S D P N H P K A C P K N C D P N I A Y S L C L Y E



KPCTLNCDPRIFYSKCPRSEASAEQPICTNCCAGLKGCNYYNADGTFICEG
CTLNC
EASAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K P C T L N C D P R I F Y S K C P R S E A S A E Q P I C T N C C A G L K G C N Y Y N A D G T F I C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-121
36 - 87 52
IRD-143
94 - 145 52
IRD-444
69 - 119 51
Amino Acid Count % by Frequency
Alanine 13 8.9
Cysteine 17 11.64
Aspartic acid 7 4.79
Glutamic acid 9 6.16
Phenylalanine 4 2.74
Glycine 9 6.16
Histidine 2 1.37
Isoleucine 7 4.79
Lysine 10 6.85
Leucine 11 7.53
Methionine 1 0.68
Asparagine 12 8.22
Proline 12 8.22
Glutamine 2 1.37
Arginine 4 2.74
Serine 10 6.85
Threonine 5 3.42
Valine 4 2.74
Tryptophan 0 0
Tyrosine 7 4.79