PINIR_415 [Q4ZIQ3]  : Pin-II type proteinase inhibitor 9

262Length

Capsicum annuumSpecie

PI-9Gene Name

28636Mass

7Domain Count

Sequence :
    FASTA
MAVPKEVSFL AFLLVLEILL LHVDAKACSE ENAENRICTN CCAGRKGCNY YSADGTFICE GESDPNNPKA 70
CPRYCDTRIA YSKCPRSEGN AENRLCTNCC AGRKGCNYYS ADGTFICEGE SDPNNPKACP RNCDTRIAYS 140
KCPRSEGNAE NRICTNCCAG RKGCNYYSAD GTFICEGESD PNNPKPCTLN CDPRIFYSKC PRSEASAEQP 210
ICTNCCAGLK GCNYYNADGT FICEGESDPN HPKACPKNCD PNIAYSLCLY EK 262
SIGNAL PEPTIDE
SEQUENCE Position
MAVPKEVSFLAFLLVLEILLLHVDA
1 ↔ 25
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
94 - 145 52
152 - 203 52
36 - 87 52
210 - 261 52
185 - 235 51
127 - 177 51
69 - 119 51
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
5
-1.3 -17.9 -29.6
CROSS REFERENCES
REFERENCES
PubMed ID:    
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-1 CPRNC Trypsin 130 - 134
RL-1 CPRNC Trypsin 130 - 134
RL-11 CPKNC Trypsin 246 - 250
RL-3 CTLNC Chymotrypsin 188 - 192
RL-3 CTLNC Chymotrypsin 188 - 192
RL-6 CPRYC Trypsin 72 - 76
RL-6 CPRYC Trypsin 72 - 76
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
leaves Helicoverpa armigera Show 60-80% reduction in protease activity,Show activity for trypsin and chymotrypsin, 35% reduction in larval weight 15715970
Fruits Helicoverpa armigera Inhibition of 70% of the gut proteinase activity of Helicoverpa armigera,Larval and pupal growth reduction 17870253
leaves Helicoverpa armigera Transgenic expression in tomato plant;IRD-9 and -12 exhibited strong inhibition (70–90%) of trypsin, chymotrypsin and HGP, while IRD-7 (40–70%) showed comparatively less inhibition 23261428
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-90 94 - 145 CPRNC 129 - 133 DPNNP 122 - 126 H-L Type (Type-I)
IRD-122 152 - 203 CTLNC 187 - 191 DPNNP 180 - 184 H-L Type (Type-I)
IRD-133 36 - 87 CPRYC 71 - 75 DPNNP 64 - 68 H-L Type (Type-I)
IRD-143 210 - 261 CPKNC 245 - 249 DPNHP 238 - 242 H-L Type (Type-I)
IRD-444 185 - 235 CTLNC 187 - 191 EASAE 204 - 208 L-H Type (Type-II)
IRD-539 127 - 177 CPRNC 129 - 133 EGNAE 146 - 150 L-H Type (Type-II)
IRD-560 69 - 119 CPRYC 71 - 75 EGNAE 88 - 92 L-H Type (Type-II)

RLCTNCCAGRKGCNYYSADGTFICEGESDPNNPKACPRNCDTRIAYSKCPRS
CPRNC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R L C T N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K A C P R N C D T R I A Y S K C P R S



RICTNCCAGRKGCNYYSADGTFICEGESDPNNPKPCTLNCDPRIFYSKCPRS
CTLNC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K P C T L N C D P R I F Y S K C P R S



RICTNCCAGRKGCNYYSADGTFICEGESDPNNPKACPRYCDTRIAYSKCPRS
CPRYC
DPNNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G R K G C N Y Y S A D G T F I C E G E S D P N N P K A C P R Y C D T R I A Y S K C P R S



PICTNCCAGLKGCNYYNADGTFICEGESDPNHPKACPKNCDPNIAYSLCLYE
CPKNC
DPNHP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
P I C T N C C A G L K G C N Y Y N A D G T F I C E G E S D P N H P K A C P K N C D P N I A Y S L C L Y E



KPCTLNCDPRIFYSKCPRSEASAEQPICTNCCAGLKGCNYYNADGTFICEG
CTLNC
EASAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K P C T L N C D P R I F Y S K C P R S E A S A E Q P I C T N C C A G L K G C N Y Y N A D G T F I C E G



KACPRNCDTRIAYSKCPRSEGNAENRICTNCCAGRKGCNYYSADGTFICEG
CPRNC
EGNAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R N C D T R I A Y S K C P R S E G N A E N R I C T N C C A G R K G C N Y Y S A D G T F I C E G



KACPRYCDTRIAYSKCPRSEGNAENRLCTNCCAGRKGCNYYSADGTFICEG
CPRYC
EGNAE
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R Y C D T R I A Y S K C P R S E G N A E N R L C T N C C A G R K G C N Y Y S A D G T F I C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-90
94 - 145 52
IRD-122
152 - 203 52
IRD-133
36 - 87 52
IRD-143
210 - 261 52
IRD-444
185 - 235 51
IRD-539
127 - 177 51
IRD-560
69 - 119 51
Amino Acid Count % by Frequency
Alanine 23 8.78
Cysteine 33 12.6
Aspartic acid 13 4.96
Glutamic acid 20 7.63
Phenylalanine 7 2.67
Glycine 18 6.87
Histidine 2 0.76
Isoleucine 12 4.58
Lysine 15 5.73
Leucine 12 4.58
Methionine 1 0.38
Asparagine 26 9.92
Proline 19 7.25
Glutamine 1 0.38
Arginine 14 5.34
Serine 17 6.49
Threonine 11 4.2
Valine 4 1.53
Tryptophan 0 0
Tyrosine 14 5.34