PINIR_51 [Q1WL39]  : Trypsin proteinase inhibitor

397Length

Nicotiana paucifloraSpecie

PIGene Name

43846Mass

11Domain Count

Sequence :
    FASTA
MAVHRVSFLA LLLLFGMSLL VSNVEHADAM ACPFNCDPRI AYEVCPRTEE KKNDRICTNC CAGTKGCKYF 70
SDDGTFICEG ESDPRNPKAC PRNCDGRIAY GICPLSEEKK NDRICTNCCV GTKGCKYFSD DGTFICEGES 140
DPRNPKACPR NCDGRIAYGI CPRTEEKKND RICTNCCAGT KGCKYFSDDG TFICEGESDP RNPKACPRNC 210
DGRIAYGICP RTEEKKNDRI CTNCCAGTKG CKYFSDDGTF VCEGESDPRN PKACPRNCDG RIAYGICPRT 280
EEKKNDRICT NCCAGTKGCK YFSDDGTFVC EGESDPRNPK ACPRNCDERI AYGICPRTEE KKNNQICTNC 350
CAGTKGCNYF SANGTFICEG ESEYVSKVDE YVHEVENDLQ KSRVAVS 397
SIGNAL PEPTIDE
SEQUENCE Position
MAVHRVSFLALLLLFGMSLLVSNVEHADA
1 ↔ 29
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
287 - 338 52
55 - 106 52
113 - 164 52
171 - 222 52
229 - 280 52
320 - 370 51
88 - 138 51
146 - 196 51
204 - 254 51
262 - 312 51
30 - 80 51
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
5.754
2.3 -22.4 -39.8
CROSS REFERENCES
REFERENCES
PubMed ID:     16534618    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-1 CPRNC Trypsin 91 - 95
RL-1 CPRNC Trypsin 91 - 95
RL-1 CPRNC Trypsin 149 - 153
RL-1 CPRNC Trypsin 149 - 153
RL-1 CPRNC Trypsin 207 - 211
RL-1 CPRNC Trypsin 207 - 211
RL-1 CPRNC Trypsin 265 - 269
RL-1 CPRNC Trypsin 265 - 269
RL-1 CPRNC Trypsin 323 - 327
RL-1 CPRNC Trypsin 323 - 327
RL-5 CPFNC Chymotrypsin 33 - 37
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
No Records Found
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-169 287 - 338 CPRNC 322 - 326 DPRNP 315 - 319 H-L Type (Type-I)
IRD-193 55 - 106 CPRNC 90 - 94 DPRNP 83 - 87 H-L Type (Type-I)
IRD-194 113 - 164 CPRNC 148 - 152 DPRNP 141 - 145 H-L Type (Type-I)
IRD-195 171 - 222 CPRNC 206 - 210 DPRNP 199 - 203 H-L Type (Type-I)
IRD-196 229 - 280 CPRNC 264 - 268 DPRNP 257 - 261 H-L Type (Type-I)
IRD-619 320 - 370 CPRNC 322 - 326 EEKKN 339 - 343 L-H Type (Type-II)
IRD-629 88 - 138 CPRNC 90 - 94 EEKKN 107 - 111 L-H Type (Type-II)
IRD-630 146 - 196 CPRNC 148 - 152 EEKKN 165 - 169 L-H Type (Type-II)
IRD-631 204 - 254 CPRNC 206 - 210 EEKKN 223 - 227 L-H Type (Type-II)
IRD-631 262 - 312 CPRNC 264 - 268 EEKKN 281 - 285 L-H Type (Type-II)
IRD-667 30 - 80 CPFNC 32 - 36 EEKKN 49 - 53 L-H Type (Type-II)

RICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACPRNCDERIAYGICPRT
CPRNC
DPRNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G T K G C K Y F S D D G T F V C E G E S D P R N P K A C P R N C D E R I A Y G I C P R T



RICTNCCAGTKGCKYFSDDGTFICEGESDPRNPKACPRNCDGRIAYGICPLS
CPRNC
DPRNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G T K G C K Y F S D D G T F I C E G E S D P R N P K A C P R N C D G R I A Y G I C P L S



RICTNCCVGTKGCKYFSDDGTFICEGESDPRNPKACPRNCDGRIAYGICPRT
CPRNC
DPRNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C V G T K G C K Y F S D D G T F I C E G E S D P R N P K A C P R N C D G R I A Y G I C P R T



RICTNCCAGTKGCKYFSDDGTFICEGESDPRNPKACPRNCDGRIAYGICPRT
CPRNC
DPRNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G T K G C K Y F S D D G T F I C E G E S D P R N P K A C P R N C D G R I A Y G I C P R T



RICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACPRNCDGRIAYGICPRT
CPRNC
DPRNP
H-L Type (Type-I)
3,40 ; 6,24 ; 7,36 ; 13,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G T K G C K Y F S D D G T F V C E G E S D P R N P K A C P R N C D G R I A Y G I C P R T



KACPRNCDERIAYGICPRTEEKKNNQICTNCCAGTKGCNYFSANGTFICEG
CPRNC
EEKKN
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R N C D E R I A Y G I C P R T E E K K N N Q I C T N C C A G T K G C N Y F S A N G T F I C E G



KACPRNCDGRIAYGICPLSEEKKNDRICTNCCVGTKGCKYFSDDGTFICEG
CPRNC
EEKKN
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R N C D G R I A Y G I C P L S E E K K N D R I C T N C C V G T K G C K Y F S D D G T F I C E G



KACPRNCDGRIAYGICPRTEEKKNDRICTNCCAGTKGCKYFSDDGTFICEG
CPRNC
EEKKN
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R N C D G R I A Y G I C P R T E E K K N D R I C T N C C A G T K G C K Y F S D D G T F I C E G



KACPRNCDGRIAYGICPRTEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEG
CPRNC
EEKKN
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R N C D G R I A Y G I C P R T E E K K N D R I C T N C C A G T K G C K Y F S D D G T F V C E G



KACPRNCDGRIAYGICPRTEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEG
CPRNC
EEKKN
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P R N C D G R I A Y G I C P R T E E K K N D R I C T N C C A G T K G C K Y F S D D G T F V C E G



MACPFNCDPRIAYEVCPRTEEKKNDRICTNCCAGTKGCKYFSDDGTFICEG
CPFNC
EEKKN
L-H Type (Type-II)
3,28 ; 7,32 ; 16,38 ; 31,49
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
M A C P F N C D P R I A Y E V C P R T E E K K N D R I C T N C C A G T K G C K Y F S D D G T F I C E G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-169
287 - 338 52
IRD-193
55 - 106 52
IRD-194
113 - 164 52
IRD-195
171 - 222 52
IRD-196
229 - 280 52
IRD-619
320 - 370 51
IRD-629
88 - 138 51
IRD-630
146 - 196 51
IRD-631
204 - 254 51
IRD-631
262 - 312 51
IRD-667
30 - 80 51
Amino Acid Count % by Frequency
Alanine 23 5.79
Cysteine 48 12.09
Aspartic acid 29 7.3
Glutamic acid 31 7.81
Phenylalanine 15 3.78
Glycine 34 8.56
Histidine 3 0.76
Isoleucine 21 5.29
Lysine 30 7.56
Leucine 9 2.27
Methionine 3 0.76
Asparagine 28 7.05
Proline 23 5.79
Glutamine 2 0.5
Arginine 28 7.05
Serine 19 4.79
Threonine 23 5.79
Valine 14 3.53
Tryptophan 0 0
Tyrosine 14 3.53