PINIR_65 [A0A2Z7C1T8]  : Uncharacterized protein

60Length

Dorcoceras hygrometricumSpecie

F511_05130Gene Name

6434Mass

1Domain Count

Sequence :
    FASTA
MFLLGMNESV VRVMACPLYC LDVEYMTCNG TKVTPGRCNC CLAPKGCILH LSDGTSVNCG 60
SIGNAL PEPTIDE
SEQUENCE Position
DOMAINS ARCHITECTURE  
Domain Position Length Architecture
14 - 60 47
ISO - ELECTRIC POINT
Iso Eelectric Point charge at pH 7.4 charge at pH 5.5 charge at pH 8.0
6.222
0.7 -3.3 -6.1
CROSS REFERENCES
REFERENCES
PubMed ID:     25902549    |
Application:
REACTIVE LOOPS
Entry RCL Sequence Target Protease Position
RL-27 CPLYC Chymotrypsin 17 - 21
GO TERMS
Molecular Function Cellular Component Biological Process
serine-type endopeptidase inhibitor activity (GO:0004867) None None
SPATIO TEMPORAL DISTRIBUTION
Tissue Distribution Induction Elicitor Molecules Target Insect Remarks Reference
Genome assembly 25902549
BIO-CHEMICAL PROPERTIES
Ki (uM) IC50 (uM) Target Protease Cross Reactivity Remarks Reference
No Records Found
BIO-PHYSICAL PROPERTIES
Affinity Binding Energy Stability Remarks Reference
No Records Found
DOMAIN STRUCTURE FOLD
Beta Sheet Numbers Alpha Helix Numbers Coil Numbers Disulphide Bonds Numbers Remarks Reference
No Records Found
Entry Domain Position RCL RCL Position Linker Linker Position Domain Type
IRD-677 14 - 60 CPLYC 16 - 20 - H+L Type (Type-III)

MACPLYCLDVEYMTCNGTKVTPGRCNCCLAPKGCILHLSDGTSVNCG
CPLYC
H+L Type (Type-III)
3,25 ; 7,15 ; 27,46 ; 28,34
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47
M A C P L Y C L D V E Y M T C N G T K V T P G R C N C C L A P K G C I L H L S D G T S V N C G



DOMAINS ARCHITECTURE
Domain Position Length Architecture
IRD-677
14 - 60 47
Amino Acid Count % by Frequency
Alanine 2 3.33
Cysteine 8 13.33
Aspartic acid 2 3.33
Glutamic acid 2 3.33
Phenylalanine 1 1.67
Glycine 6 10
Histidine 1 1.67
Isoleucine 1 1.67
Lysine 2 3.33
Leucine 7 11.67
Methionine 4 6.67
Asparagine 4 6.67
Proline 3 5
Glutamine 0 0
Arginine 2 3.33
Serine 3 5
Threonine 4 6.67
Valine 6 10
Tryptophan 0 0
Tyrosine 2 3.33